Lus10006840 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G21360 174 / 9e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037585 239 / 3e-80 AT3G21360 454 / 2e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10006839 207 / 9e-68 AT3G21360 435 / 3e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10006838 165 / 4e-51 AT3G21360 397 / 5e-139 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10006835 163 / 2e-50 AT3G21360 375 / 4e-130 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10025818 159 / 2e-48 AT3G21360 496 / 6e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10038283 156 / 1e-47 AT3G21360 494 / 1e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10025819 124 / 2e-35 AT3G21360 428 / 2e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10038282 120 / 2e-34 AT3G21360 367 / 2e-128 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10035053 79 / 4e-18 AT3G21360 246 / 4e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G190100 169 / 1e-52 AT3G21360 501 / 5e-180 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G131200 84 / 3e-20 AT3G21360 250 / 2e-81 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G131300 83 / 8e-20 AT3G21360 241 / 3e-78 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF02668 TauD Taurine catabolism dioxygenase TauD, TfdA family
Representative CDS sequence
>Lus10006840 pacid=23144402 polypeptide=Lus10006840 locus=Lus10006840.g ID=Lus10006840.BGIv1.0 annot-version=v1.0
ATGTTTGCTGCAACCATAAACTGCAGGGCGGAAAACTTAGGGATGAAGCTGGAGTGGATTTCCGCCGTAGACGACTGCAGATCGGTGGCCAAGACATCGA
TCGGTCCGATCCCAGCAATCAAATTCGACAAGTCGAGGAACTACAAAGTCTGGTTCAACGCATTGGTGACAAGCTACACGGCCTTCGGCGACAAAAGAAA
CGATTCGGCCAAGTCCATCGCGTTCGGCGGCGGCGATCCTCTGCCTAGCGACGCCGTGTATGGCTGCCTGAGGATCATGGAAGAGCTGAGCGTCGCGGTT
CCTTGGCAGAAGGGTGACGTCCTGATGATCGATAATTGGGCCGTTCTTCATTCTCGTAAGCTCTTCACCCCGCCTCGTCGAGTTCTCGCTGCACTCTGCA
AGTAA
AA sequence
>Lus10006840 pacid=23144402 polypeptide=Lus10006840 locus=Lus10006840.g ID=Lus10006840.BGIv1.0 annot-version=v1.0
MFAATINCRAENLGMKLEWISAVDDCRSVAKTSIGPIPAIKFDKSRNYKVWFNALVTSYTAFGDKRNDSAKSIAFGGGDPLPSDAVYGCLRIMEELSVAV
PWQKGDVLMIDNWAVLHSRKLFTPPRRVLAALCK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G21360 2-oxoglutarate (2OG) and Fe(II... Lus10006840 0 1
AT1G68390 Core-2/I-branching beta-1,6-N-... Lus10035828 4.5 0.8040
AT1G19090 CRK1, RKF2 CYSTEINE-RICH RLK \(RECEPTOR-L... Lus10033450 4.8 0.8558
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10010943 8.3 0.8343
AT5G50220 F-box family protein (.1) Lus10015170 9.1 0.8418
AT5G07610 F-box family protein (.1) Lus10042990 9.3 0.6977
AT5G24530 DMR6 DOWNY MILDEW RESISTANT 6, 2-ox... Lus10035782 21.8 0.8060
AT1G24590 AP2_ERF ESR2, DRNL, SOB... FOR SUPPRESSOR OF PHYTOCHROMEB... Lus10035076 25.6 0.6489
AT2G38150 alpha 1,4-glycosyltransferase ... Lus10027771 26.6 0.7902
AT2G45760 BAL, BAP2 BON ASSOCIATION PROTEIN 1-LIKE... Lus10040923 30.7 0.7727
AT5G15430 Plant calmodulin-binding prote... Lus10015733 31.5 0.7896

Lus10006840 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.