Lus10006846 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G19770 198 / 6e-67 PRF5 profilin 5 (.1)
AT4G29340 194 / 2e-65 PRF4 profilin 4 (.1)
AT2G19760 186 / 3e-62 PRF1, PFN1 profilin 1 (.1)
AT4G29350 181 / 3e-60 PRF2, PFN2, PRO2 profilin 2 (.1)
AT5G56600 182 / 6e-60 PRF3, PFN3 profilin 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037591 239 / 5e-83 AT2G19770 231 / 6e-80 profilin 5 (.1)
Lus10011138 205 / 1e-69 AT2G19760 225 / 2e-77 profilin 1 (.1)
Lus10043040 204 / 3e-69 AT5G56600 223 / 1e-76 profilin 3 (.1.2)
Lus10012936 203 / 1e-68 AT4G29350 223 / 2e-76 profilin 2 (.1)
Lus10034988 200 / 1e-67 AT4G29340 219 / 3e-75 profilin 4 (.1)
Lus10043041 199 / 6e-67 AT4G29340 239 / 9e-83 profilin 4 (.1)
Lus10034989 196 / 6e-66 AT4G29340 234 / 6e-81 profilin 4 (.1)
Lus10011139 193 / 7e-65 AT4G29340 238 / 1e-82 profilin 4 (.1)
Lus10012935 191 / 4e-64 AT4G29340 235 / 2e-81 profilin 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G047700 211 / 5e-72 AT4G29340 224 / 5e-77 profilin 4 (.1)
Potri.001G190800 210 / 1e-71 AT2G19760 196 / 8e-66 profilin 1 (.1)
Potri.006G235200 200 / 2e-67 AT4G29340 216 / 1e-73 profilin 4 (.1)
Potri.018G057600 196 / 7e-66 AT4G29340 188 / 5e-63 profilin 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF00235 Profilin Profilin
Representative CDS sequence
>Lus10006846 pacid=23144418 polypeptide=Lus10006846 locus=Lus10006846.g ID=Lus10006846.BGIv1.0 annot-version=v1.0
ATGTCGTGGCAGACTTACGTCGACGAGCACCTGATGTGCGATATTGAAGGCAACCACCTCGCATCCGCCGCTATCATCGGCCACGACGGCAGCGTCTGGG
CTCAGAGCGCCAACTTCCCAGCGTGTAAACCAGAGGAGATAACTGCAATGATGAAGGATTTTGACGAGCCTGGGACTCTTGCCCCAACCGGATTGCACCT
CGCTGGAGCAAAGTATATGGTGATCCAAGGAGAGGCAGGAGCTGTGATTCGTGGAAAGAAGGGTGCGGGAGGCGTGACAGTAAAGAAAACAGGGCAAGCA
CTAGTGTTCGGTCTGTACGAAGAACCAGTAACTCCGGGACAATGCAACATGGTCGTCGAGAGGTTGGGAGATTACCTTGTTGATCAAGGACTCTAA
AA sequence
>Lus10006846 pacid=23144418 polypeptide=Lus10006846 locus=Lus10006846.g ID=Lus10006846.BGIv1.0 annot-version=v1.0
MSWQTYVDEHLMCDIEGNHLASAAIIGHDGSVWAQSANFPACKPEEITAMMKDFDEPGTLAPTGLHLAGAKYMVIQGEAGAVIRGKKGAGGVTVKKTGQA
LVFGLYEEPVTPGQCNMVVERLGDYLVDQGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G19770 PRF5 profilin 5 (.1) Lus10006846 0 1
AT5G65470 O-fucosyltransferase family pr... Lus10002653 1.4 0.8771
AT5G65470 O-fucosyltransferase family pr... Lus10012732 2.4 0.8083
AT1G10550 XTH33, XET xyloglucan:xyloglucosyl transf... Lus10013000 3.5 0.7950
AT2G19770 PRF5 profilin 5 (.1) Lus10037591 5.1 0.8471
AT1G31850 S-adenosyl-L-methionine-depend... Lus10034729 8.4 0.7793
AT4G19410 Pectinacetylesterase family pr... Lus10034762 13.7 0.7266
AT2G31680 AtRABA5d RAB GTPase homolog A5D (.1) Lus10025516 13.9 0.7773
AT1G12390 Cornichon family protein (.1) Lus10028906 16.7 0.7550
AT1G05070 Protein of unknown function (D... Lus10030034 19.3 0.7012
AT4G17350 Plant protein of unknown funct... Lus10004734 24.6 0.6228

Lus10006846 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.