Lus10006851 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33270 704 / 0 AtCDC20.1, CDC20.1 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
AT4G33260 684 / 0 AtCDC20.2, CDC20.2 cell division cycle 20.2, Transducin family protein / WD-40 repeat family protein (.1.2)
AT5G26900 596 / 0 AtCDC20.4 cell division cycle 20.4, Transducin family protein / WD-40 repeat family protein (.1)
AT5G27080 594 / 0 AtCDC20.3 cell division cycle 20.3, Transducin family protein / WD-40 repeat family protein (.1)
AT5G27570 577 / 0 AtCDC20.5 cell division cycle 20.5, Transducin/WD40 repeat-like superfamily protein (.1)
AT5G27945 461 / 6e-161 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G13840 328 / 5e-108 FZR3 FIZZY-related 3 (.1.2)
AT4G22910 325 / 8e-107 CCS52A1, FZR2 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
AT4G11920 316 / 2e-103 FZR1, CCS52A2 FIZZY-RELATED 1, cell cycle switch protein 52 A2 (.1)
AT1G11160 82 / 3e-16 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037593 851 / 0 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10006853 847 / 0 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10034687 674 / 0 AT4G33270 620 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10042748 635 / 0 AT4G33270 592 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10042765 569 / 0 AT4G33270 542 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10037595 424 / 2e-149 AT4G33270 402 / 2e-141 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10040282 335 / 8e-108 AT5G13840 685 / 0.0 FIZZY-related 3 (.1.2)
Lus10043009 324 / 7e-107 AT4G33270 344 / 1e-114 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10025838 305 / 7e-103 AT4G33270 295 / 3e-99 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G118400 719 / 0 AT4G33270 771 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.013G048900 712 / 0 AT4G33270 766 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.019G021800 708 / 0 AT4G33270 767 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.016G068700 617 / 0 AT4G33270 607 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.015G110300 351 / 3e-117 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.010G202100 328 / 5e-108 AT5G13840 707 / 0.0 FIZZY-related 3 (.1.2)
Potri.008G057500 319 / 2e-104 AT5G13840 705 / 0.0 FIZZY-related 3 (.1.2)
Potri.001G112700 315 / 4e-103 AT4G22910 705 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
Potri.003G119500 311 / 2e-101 AT4G22910 702 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
Potri.008G002300 83 / 1e-16 AT5G08390 1006 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0186 Beta_propeller PF00400 WD40 WD domain, G-beta repeat
Representative CDS sequence
>Lus10006851 pacid=23144387 polypeptide=Lus10006851 locus=Lus10006851.g ID=Lus10006851.BGIv1.0 annot-version=v1.0
ATGAACACCAGATTTCCACTCCAGAGAAAGAGTTCCAAGGATAACCTGGACAGGTTCATTCCGAATCGGTCAGCTATGGACATGGATTACGCCCACTACA
TGGCCACAGAAGGATGGAAAGAACCGGAGAATCCAGTCCCCAGTTCCCCTTCAAGCGAGGCTTACAAGAGACTGCTGGCGGAGACTATGAACTTGAATCG
GACAAGGATCTTGGCGTTCAAGAACAAGCCTCCTACTCCTGTTGAATTGATCCCGCATTTCCACACTTCTTCTTCAGATTCATCTCTTCCTCACCAGATG
AAACCAGCCAAGCCTCGCAGACACATTCCTCAGACTTCAGAGAGGACATTGGATGCTCCCGACCTTGTGGATGATTTTTACTTGAACTTACTGGACTGGG
GAAGCAGCAATGTTCTTGCAATAGGATTGGGAAGTACTGTTTATCTCTGGGGCGCTTCCAATGGCTCTACTTCCGAGCTTGTCACTGTCGATGAAGAACT
CGGCCCTGTGACTAGCGTTAACTGGGCTCCCGATGGACAGAATATCGCTATTGGTTTGAACAACTCTGAAGTCCAACTGTGGGATTCTACTTCTAACAAA
CTGCTAAGAACATTGAGAGGCGGCCATAGATGCAGAGTCGGGTCATTGGCATGGAACAACCACATCTTAACCACTGGAGGAATGGATGGAAGGATTATAA
ACAACGATGTCCGAATCCGAAAACACATAGTTGAAACATACAGAGGCCACACGCAAGAAGTCTGCGGATTGAAATGGTCAGCTTCAGGTCAACAACTAGC
AAGCGGAGGAAACGATAATCTGGTTCATATCTGGGACAGATCCATGGCTTCTTCCAACTTGCCAACTCAGTATCTTCACCGACTCGAAGACCATACATCA
GCTGTAAAGGCTCTAGCTTGGTGTCCGTTTCAAGGAAACTTGCTCGCGACGGGAGGCGGTGGAGGAGACAGGACGATCAAGTTCTGGAACACTCATACCG
GTGCGTGCTTGAACTCGGTGGACACTGGATCCCAGGTGTGTGCGCTGCTGTGGAACAAGAACGAGAGGGAGCTTCTGAGCTCTCATGGGTTTACTCAGAA
TCAGCTTACCTTGTGGAAGTATCCGTCCATGGTGAAGACTGCAGAGCTTACTGGCCACACCTCCAGGGTTTTGTTCATGGCTCAGAGTCCCAATGGGTGC
ACTGTGGCGTCAGCAGCAGGGGATGAAACTCTGAGGTTCTGGAACGTGTTTGGGGATCCTGAAGCTGCTAAGAAATCTGCTCCTAAAGCCAACCCCGAGC
CGTTCGCTTTGGCCAATCGCATCCGCTGA
AA sequence
>Lus10006851 pacid=23144387 polypeptide=Lus10006851 locus=Lus10006851.g ID=Lus10006851.BGIv1.0 annot-version=v1.0
MNTRFPLQRKSSKDNLDRFIPNRSAMDMDYAHYMATEGWKEPENPVPSSPSSEAYKRLLAETMNLNRTRILAFKNKPPTPVELIPHFHTSSSDSSLPHQM
KPAKPRRHIPQTSERTLDAPDLVDDFYLNLLDWGSSNVLAIGLGSTVYLWGASNGSTSELVTVDEELGPVTSVNWAPDGQNIAIGLNNSEVQLWDSTSNK
LLRTLRGGHRCRVGSLAWNNHILTTGGMDGRIINNDVRIRKHIVETYRGHTQEVCGLKWSASGQQLASGGNDNLVHIWDRSMASSNLPTQYLHRLEDHTS
AVKALAWCPFQGNLLATGGGGGDRTIKFWNTHTGACLNSVDTGSQVCALLWNKNERELLSSHGFTQNQLTLWKYPSMVKTAELTGHTSRVLFMAQSPNGC
TVASAAGDETLRFWNVFGDPEAAKKSAPKANPEPFALANRIR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G33270 AtCDC20.1, CDC2... cell division cycle 20.1, Tran... Lus10006851 0 1
AT2G33560 BUBR1 BUB1-related (BUB1: budding un... Lus10030714 1.4 0.9756
AT1G49870 unknown protein Lus10002116 2.0 0.9754
AT3G03130 unknown protein Lus10009977 3.0 0.9741
AT3G44600 AtCYP71, CYP71 cyclophilin 71, cyclophilin71 ... Lus10020573 4.0 0.9502
AT4G32830 ATAUR1 ataurora1 (.1) Lus10005487 4.2 0.9704
AT5G17160 unknown protein Lus10038036 4.5 0.9704
AT3G44050 P-loop containing nucleoside t... Lus10008438 5.7 0.9704
AT4G15830 ARM repeat superfamily protein... Lus10034168 5.7 0.9611
AT2G33560 BUBR1 BUB1-related (BUB1: budding un... Lus10013199 7.3 0.9601
AT3G12870 unknown protein Lus10031776 8.4 0.9544

Lus10006851 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.