Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017954 [exp] 89 / 4e-25 ND / Lus10041943 [exp] 87 / 5e-24 ND / Lus10041941 [exp] 82 / 3e-22 ND / Lus10041944 [exp] 71 / 1e-17 ND / Lus10017955 [exp] 68 / 8e-17 ND / Lus10019472 [exp] 57 / 4e-12 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G085901 [exp] 57 / 2e-12 ND / Potri.012G086200 [exp] 50 / 1e-09 ND / Potri.015G084101 [exp] 50 / 1e-09 ND / Potri.012G085800 [exp] 50 / 3e-09 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006897 pacid=23142121 polypeptide=Lus10006897 locus=Lus10006897.g ID=Lus10006897.BGIv1.0 annot-version=v1.0 ATGGACAAGAACACCCATGATTACCACACCTACATATCGGCCATGATGAGGGCTCCCAGCATCATGCACGGCGTTCCTCAATACCCGGACGTCCACAAGG CCTTCAAGCAGGATCCGGCTTACTACTACGAACAAGACCAGAAGCAGAAACAGAAGCAGCAGCCAGAGATAGAGCAGCAGCAGAAGAAGAAGAACAAGAA GAAGAAGATTTTCGATCTCTGCAAATGGAAGACCTTCAGGCTTTGA
AA sequence Show only first row Show all	>Lus10006897 pacid=23142121 polypeptide=Lus10006897 locus=Lus10006897.g ID=Lus10006897.BGIv1.0 annot-version=v1.0 MDKNTHDYHTYISAMMRAPSIMHGVPQYPDVHKAFKQDPAYYYEQDQKQKQKQQPEIEQQQKKKNKKKKIFDLCKWKTFRL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006897 [exp]	0	1
AT3G25160			ER lumen protein retaining rec...		Lus10038198 [exp]	3.5	0.8434
AT3G10710		RHS12	root hair specific 12 (.1)		Lus10017118 [exp]	4.6	0.7989
					Lus10013380 [exp]	5.0	0.8065
AT3G27810	MYB	AtMYB3, ATMYB21	ARABIDOPSIS THALIANA MYB DOMA...		Lus10022259 [exp]	5.0	0.8776
AT3G18150			RNI-like superfamily protein (...		Lus10029586 [exp]	6.1	0.7481
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Lus10028473 [exp]	6.3	0.8279
AT4G36590	MADS		MADS-box transcription factor ...		Lus10028490 [exp]	11.7	0.7190
AT4G35160			O-methyltransferase family pro...		Lus10008538 [exp]	15.2	0.8362
					Lus10041547 [exp]	20.3	0.7437
AT1G62935			unknown protein		Lus10009297 [exp]	26.6	0.7879

Compare expression of checked genes

Lus10006897 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.