Lus10006905 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G23535 280 / 2e-98 KOW domain-containing protein (.1)
AT5G54600 66 / 1e-13 Translation protein SH3-like family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042614 300 / 2e-106 AT5G23535 286 / 6e-101 KOW domain-containing protein (.1)
Lus10022069 298 / 2e-105 AT5G23535 284 / 5e-100 KOW domain-containing protein (.1)
Lus10014683 164 / 3e-50 AT2G48140 145 / 6e-43 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10005180 71 / 2e-15 AT5G54600 246 / 3e-83 Translation protein SH3-like family protein (.1.2)
Lus10038125 71 / 3e-15 AT5G54600 246 / 6e-83 Translation protein SH3-like family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G062600 295 / 2e-104 AT5G23535 254 / 6e-88 KOW domain-containing protein (.1)
Potri.001G415400 66 / 6e-14 AT5G54600 243 / 2e-82 Translation protein SH3-like family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF00467 KOW KOW motif
Representative CDS sequence
>Lus10006905 pacid=23142091 polypeptide=Lus10006905 locus=Lus10006905.g ID=Lus10006905.BGIv1.0 annot-version=v1.0
ATGGGTTGGAAGGCAGCTGAAAAGCTAATCAGACACTGGAAAATACTCAGAGGAGATAATGTGAGAATGCTGCTGGGCAAGGATAAAGGCGAGACTGGTG
TCGTCAAACGTGTGGTTCGCTCTCAGAATCGTGTTATTGTTGAGGGCAAAAATCTGGTTAAAAAGCATATAAAAGCAGGTGAAGGTCACGAAGGAGGAAT
TTTTACAGTTGAAGCTCCACTCCATGCCTCAAATGTCCAAGTTGTTGATCCAGTCACAGGGAGGCCTTGCAAGGTGGGGATCAAGTATCTTGAGGATGGT
ACCAAAGTAAGAGTTTCAAGAGGTATCGGAGCATCTGGATCCATCATTCCGCGTCCGGAGATTCTGAAAGTAAGAACGACACCAAGGCCTACCGTAGCCG
GTCCGAAGGATACTCCGATGGACGTGGTGCTGGAAAAGACATACGACTCTAAAACAGGGAAGGGCATGCCTCATCTTTGA
AA sequence
>Lus10006905 pacid=23142091 polypeptide=Lus10006905 locus=Lus10006905.g ID=Lus10006905.BGIv1.0 annot-version=v1.0
MGWKAAEKLIRHWKILRGDNVRMLLGKDKGETGVVKRVVRSQNRVIVEGKNLVKKHIKAGEGHEGGIFTVEAPLHASNVQVVDPVTGRPCKVGIKYLEDG
TKVRVSRGIGASGSIIPRPEILKVRTTPRPTVAGPKDTPMDVVLEKTYDSKTGKGMPHL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G23535 KOW domain-containing protein ... Lus10006905 0 1
AT1G21720 PBC1 proteasome beta subunit C1 (.1... Lus10020599 10.5 0.7937
AT3G16780 Ribosomal protein L19e family ... Lus10037707 16.2 0.8244
AT3G53740 Ribosomal protein L36e family ... Lus10016466 18.1 0.8215
AT5G41685 Mitochondrial outer membrane t... Lus10040758 23.0 0.8093
AT5G59440 ATTMPK.2, ATTMP... ZEUS1, ARABIDOPSIS THALIANA TH... Lus10035500 39.8 0.7610
AT1G07770 RPS15A ribosomal protein S15A (.1.2) Lus10032503 44.5 0.7982
AT4G25740 RNA binding Plectin/S10 domain... Lus10039282 53.2 0.7689
AT2G29530 TIM10 Tim10/DDP family zinc finger p... Lus10016453 59.3 0.7767
AT5G41685 Mitochondrial outer membrane t... Lus10000059 66.0 0.7659
AT1G26880 Ribosomal protein L34e superfa... Lus10012829 78.9 0.7785

Lus10006905 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.