Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G48140 105 / 4e-30 EDA4 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G05450 82 / 2e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22620 70 / 1e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 52 / 6e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 47 / 3e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 46 / 7e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G43720 45 / 3e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G14815 44 / 3e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44290 43 / 1e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44300 39 / 0.0003 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014683 [exp] 183 / 3e-58 AT2G48140 145 / 6e-43 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10022067 [exp] 124 / 2e-36 AT2G48140 122 / 2e-35 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10042613 [exp] 108 / 8e-31 AT2G48140 107 / 1e-29 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10010575 [exp] 94 / 8e-25 AT1G05450 142 / 2e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10021911 [exp] 79 / 6e-19 AT1G05450 121 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10041196 [exp] 79 / 7e-19 AT1G05450 122 / 5e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10014681 [exp] 52 / 5e-09 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 49 / 9e-08 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 49 / 1e-07 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G212000 [exp] 124 / 1e-36 AT2G48140 113 / 4e-32 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.002G050200 [exp] 106 / 8e-30 AT2G48140 127 / 1e-37 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085200 [exp] 94 / 1e-24 AT1G05450 134 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.008G155200 [exp] 91 / 1e-23 AT2G48140 121 / 2e-34 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085400 [exp] 50 / 2e-08 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 50 / 3e-08 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G158100 [exp] 41 / 4e-05 AT3G43720 106 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G020200 [exp] 40 / 9e-05 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.004G196000 [exp] 40 / 0.0002 AT3G43720 94 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.005G211800 [exp] 39 / 0.0003 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10006906 pacid=23142089 polypeptide=Lus10006906 locus=Lus10006906.g ID=Lus10006906.BGIv1.0 annot-version=v1.0 ATGCTACTAGCAACAACAACTCTAGTACTTCTCACATGCTCGAATTTCGGATCAGTGCAAGCCCAGCAGACAATCAGCACGCCATGCACGACTTCAATGA TAGTCAGCTTCTCCCCGTGCCTGAATTATTTAACAGGGAGCAGCAACAACGGAAGCTCACCTACTGCCACGTGCTGCAACGCCCTAAAGGGACTGGTGAG TAGTAGCATGGAATGTGCTTGCCTTTTGGTCACTGCAAATGTGCCTCTTCAGTTGCCTCGACCCGTCGCTGTTCCCCTTCCTAGAGCTTGCAAGATGGGC GTCCCCTTGAGATGCAAAGCTTCTGGGTCTCCTTTGCCGGCACCAGGGCCTACCATTTTGGGTGGCCCGCCTACTCCTAATAGCCCATAA
AA sequence Show only first row Show all	>Lus10006906 pacid=23142089 polypeptide=Lus10006906 locus=Lus10006906.g ID=Lus10006906.BGIv1.0 annot-version=v1.0 MLLATTTLVLLTCSNFGSVQAQQTISTPCTTSMIVSFSPCLNYLTGSSNNGSSPTATCCNALKGLVSSSMECACLLVTANVPLQLPRPVAVPLPRACKMG VPLRCKASGSPLPAPGPTILGGPPTPNSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G48140		EDA4	embryo sac development arrest ...		Lus10006906 [exp]	0	1
AT5G14230			unknown protein		Lus10036990 [exp]	2.4	0.9373
AT2G37360		ABCG2	ATP-binding cassette G2, ABC-2...		Lus10025281 [exp]	4.6	0.9203
AT2G48140		EDA4	embryo sac development arrest ...		Lus10014683 [exp]	7.2	0.9219
AT5G37690			SGNH hydrolase-type esterase s...		Lus10018641 [exp]	7.3	0.9123
AT2G21100			Disease resistance-responsive ...		Lus10025065 [exp]	7.5	0.9160
AT2G30210		LAC3	laccase 3 (.1)		Lus10042249 [exp]	9.7	0.9130
AT1G32910			HXXXD-type acyl-transferase fa...		Lus10034786 [exp]	10.6	0.9068
AT5G37690			SGNH hydrolase-type esterase s...		Lus10039877 [exp]	12.0	0.8986
AT3G08680			Leucine-rich repeat protein ki...		Lus10025210 [exp]	13.5	0.9102
AT2G30210		LAC3	laccase 3 (.1)		Lus10026401 [exp]	15.2	0.8952

Compare expression of checked genes

Lus10006906 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.