Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14815 57 / 8e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 57 / 8e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 51 / 2e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 44 / 9e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13820 38 / 0.0007 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014681 [exp] 149 / 2e-46 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10022066 [exp] 74 / 8e-17 AT3G22600 121 / 2e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042612 [exp] 69 / 7e-15 AT3G22600 121 / 9e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 59 / 3e-11 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042611 [exp] 59 / 3e-11 AT3G22600 142 / 1e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 58 / 6e-11 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 54 / 3e-09 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10022065 [exp] 52 / 8e-09 AT3G22600 143 / 4e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039349 [exp] 51 / 2e-08 AT3G22600 119 / 9e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G050400 [exp] 69 / 7e-15 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211800 [exp] 62 / 9e-13 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 61 / 4e-12 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 60 / 9e-12 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050500 [exp] 59 / 2e-11 AT3G22600 129 / 2e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050300 [exp] 59 / 4e-11 AT3G22600 117 / 3e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085300 [exp] 57 / 1e-10 AT3G22600 66 / 5e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211900 [exp] 50 / 6e-08 AT2G48130 89 / 3e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G210100 [exp] 40 / 0.0002 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G020200 [exp] 40 / 0.0002 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006909 pacid=23142125 polypeptide=Lus10006909 locus=Lus10006909.g ID=Lus10006909.BGIv1.0 annot-version=v1.0 ATGGCTGCAAATGGGATCCAGTTCAGTTTGGTTCTGGTCATCGCGGTAGCCGCGGCCGTGATGTTTGACGGCGCCACCGCACAATCAGGATGCACCAGCG CACTAATGTCCTTATCCCCCTGCCTTATTTATCCTCAGTGTCTCTGCCAGCTTGTCAACGGCGGCGGCGGAGGTTCGTCTCTTGGAATCACAATCAACCA AACTCGCGCTCTCGCACTTCCCTCCGACTGCAAAGTCAACACCCCGCCCGCTAGCCGCTGCGGTGGCGGAAGCAATGTGCCGTTGACTTCGCCTGGTTCA TCGACTGGCAGCCCCAAGACTCCGGCGACTGGTTCGAGTACTTCGAGCACTCCTTCAGACGACGGTAATTCACCAACTCTTGGAACTTCGGGTGCGAGCA TTACGGCAGGGATGCAGCTATATGGCAAGCTTTTCCGATTACTTGTTGTTTACTGTGCATCAGGCTTTGTTGGACTGTAG
AA sequence Show only first row Show all	>Lus10006909 pacid=23142125 polypeptide=Lus10006909 locus=Lus10006909.g ID=Lus10006909.BGIv1.0 annot-version=v1.0 MAANGIQFSLVLVIAVAAAVMFDGATAQSGCTSALMSLSPCLIYPQCLCQLVNGGGGGSSLGITINQTRALALPSDCKVNTPPASRCGGGSNVPLTSPGS STGSPKTPATGSSTSSTPSDDGNSPTLGTSGASITAGMQLYGKLFRLLVVYCASGFVGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10006909 [exp]	0	1
AT1G05450			Bifunctional inhibitor/lipid-t...		Lus10010575 [exp]	2.0	0.9396
AT2G18360			alpha/beta-Hydrolases superfam...		Lus10041747 [exp]	5.8	0.9338
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10042611 [exp]	6.3	0.9117
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10022065 [exp]	8.1	0.9048
AT5G13580		ABCG6	ATP-binding cassette G6, ABC-2...		Lus10001972 [exp]	9.9	0.9191
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10014681 [exp]	10.2	0.9174
AT2G39350		ABCG1	ATP-binding cassette G1, ABC-2...		Lus10040341 [exp]	10.4	0.8842
AT2G39350		ABCG1	ATP-binding cassette G1, ABC-2...		Lus10023465 [exp]	14.7	0.9033
AT3G11430		ATGPAT5, GPAT5	glycerol-3-phosphate acyltrans...		Lus10040277 [exp]	15.9	0.9041
AT1G05260		RCI3A, RCI3	RARE COLD INDUCIBLE GENE 3, Pe...		Lus10027164 [exp]	16.2	0.8627

Compare expression of checked genes

Lus10006909 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.