Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17930 39 / 0.0001 Aminotransferase-like, plant mobile domain family protein (.1) AT2G04865 38 / 0.0003 Aminotransferase-like, plant mobile domain family protein (.1) AT1G48120 37 / 0.0006 hydrolases;protein serine/threonine phosphatases (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027047 [exp] 167 / 1e-50 AT1G17930 119 / 1e-28 Aminotransferase-like, plant mobile domain family protein (.1) Lus10020970 [exp] 150 / 6e-45 AT1G17930 123 / 2e-30 Aminotransferase-like, plant mobile domain family protein (.1) Lus10041136 [exp] 117 / 6e-36 ND 39 / 2e-04 Lus10001981 [exp] 112 / 3e-32 AT1G17930 61 / 2e-10 Aminotransferase-like, plant mobile domain family protein (.1) Lus10006165 [exp] 109 / 5e-31 AT5G45260 66 / 5e-12 SENSITIVE TO LOW HUMIDITY 1, RESISTANT TO RALSTONIA SOLANACEARUM 1, ARABIDOPSIS THALIANA WRKY DOMAIN PROTEIN 52, Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) Lus10014633 [exp] 106 / 9e-31 AT2G04865 61 / 2e-11 Aminotransferase-like, plant mobile domain family protein (.1) Lus10005957 [exp] 98 / 4e-26 AT1G48120 75 / 1e-14 hydrolases;protein serine/threonine phosphatases (.1) Lus10000775 [exp] 82 / 9e-22 ND / Lus10008761 [exp] 87 / 2e-21 AT2G25010 79 / 1e-15 Aminotransferase-like, plant mobile domain family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10536 [flax] [poplar] PMD Plant mobile domain
Representative CDS sequence Show only first row Show all	>Lus10006913 pacid=23142122 polypeptide=Lus10006913 locus=Lus10006913.g ID=Lus10006913.BGIv1.0 annot-version=v1.0 ATGCACGAGAGGGACATGATCTCTCTCGGTAAGCATATGGGGGACTATATTGCTTATAGTGTATTCCTCTTCTGTCTTCTTGGAGGTACCCTTTTCCAGG ATAGATCGGCTGATCGATCACGGCTTCTAGGTTGGGAGTACTTCATGGGTCCGATCAGTGATGTGCCGGAGTATGCTTGGGGTGCTGGTACGCTAGCCTG GTTGTATCGGGAGTTGATGAAGGCTAGCAGGGCGGAAGCCAGGGCGATGTCAGGGTGTGGGTAG
AA sequence Show only first row Show all	>Lus10006913 pacid=23142122 polypeptide=Lus10006913 locus=Lus10006913.g ID=Lus10006913.BGIv1.0 annot-version=v1.0 MHERDMISLGKHMGDYIAYSVFLFCLLGGTLFQDRSADRSRLLGWEYFMGPISDVPEYAWGAGTLAWLYRELMKASRAEARAMSGCG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006913 [exp]	0	1
AT5G03250			Phototropic-responsive NPH3 fa...		Lus10026511 [exp]	5.5	0.6234
AT1G30710			FAD-binding Berberine family p...		Lus10023369 [exp]	8.4	0.6230
AT3G01570			Oleosin family protein (.1)		Lus10028035 [exp]	9.5	0.5087
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10031033 [exp]	18.7	0.5216
AT4G28850		ATXTH26, XTH26,...	xyloglucan endotransglucosylas...		Lus10034957 [exp]	21.6	0.5216
AT5G38940			RmlC-like cupins superfamily p...		Lus10038441 [exp]	22.4	0.5024
AT1G70780			unknown protein		Lus10039287 [exp]	24.2	0.5216
					Lus10027606 [exp]	29.0	0.5081
AT2G14440			Leucine-rich repeat protein ki...		Lus10005049 [exp]	33.3	0.4996
AT4G37840		HKL3	hexokinase-like 3 (.1)		Lus10011584 [exp]	39.9	0.4730

Compare expression of checked genes

Lus10006913 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.