Lus10006929 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G36930 144 / 4e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT1G72890 132 / 8e-36 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2)
AT1G72920 126 / 7e-35 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
AT1G72940 128 / 8e-35 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1)
AT4G16890 130 / 3e-34 BAL, SNC1 SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1, BALL, disease resistance protein (TIR-NBS-LRR class), putative (.1)
AT2G20142 125 / 4e-34 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
AT4G16990 128 / 1e-33 RLM3 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative
AT5G22690 128 / 2e-33 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G46450 128 / 2e-33 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT1G72930 118 / 5e-33 TIR toll/interleukin-1 receptor-like (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014671 370 / 7e-131 AT5G36930 144 / 4e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10006928 291 / 1e-95 AT5G36930 165 / 5e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10042020 220 / 6e-69 AT1G72890 147 / 3e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2)
Lus10013729 166 / 3e-47 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10027920 157 / 2e-46 AT5G36930 139 / 3e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10005827 152 / 2e-46 AT5G36930 95 / 2e-23 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10019142 155 / 2e-44 AT1G72890 140 / 1e-36 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2)
Lus10026845 150 / 4e-44 AT5G36930 145 / 8e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10014582 150 / 6e-44 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G105501 164 / 8e-51 AT5G36930 158 / 4e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.013G096849 159 / 9e-49 AT5G36930 167 / 4e-48 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.013G098100 157 / 3e-48 AT5G36930 159 / 1e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G069866 157 / 8e-48 AT4G12010 179 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Potri.013G097050 156 / 8e-48 AT5G36930 158 / 3e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.013G097000 167 / 6e-47 AT5G17680 571 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G070651 163 / 2e-45 AT5G17680 630 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.013G098550 162 / 3e-45 AT5G17680 593 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.T002568 159 / 3e-45 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.017G104301 162 / 4e-45 AT5G17680 566 / 1e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0173 STIR PF01582 TIR TIR domain
Representative CDS sequence
>Lus10006929 pacid=23142124 polypeptide=Lus10006929 locus=Lus10006929.g ID=Lus10006929.BGIv1.0 annot-version=v1.0
ATGCCGTTGATGCGACCATCTCCTCCACTTCCGCCGCCGCTCCCCCTGCTGCCACTGAAGTACGACGTCTTCCTCAGCTTCCGTGGAGAAGACGTCCGGG
GGAGGTTCGTGGACCACCTCTACGCCAGGCTCCACACCTTGAAAGTCAACGCCTTCATGGACGACAAGAAGCTGTCGAGGGGGAAAGTGATTGAGGACTC
GATCTTGAAGGCGATCGAACGGTCGAGAATCTCCGTGATCGTGTTCTCCCCCGGGTTCGCTGACTCGGACTGGTGCCTGGACGAGCTGGTCAAGATCGTG
CGGTGCATAACCAGCTTTGGGCACGTGGCTATACCGATCTTCTTCCACGTGTCCCCTGACGACGTGGCGGCGCAGGCCGGGGTTTATAAGAAGGCGTTTG
CACAGCACGCGAAGGTGTTTACGAAGCAGAGGGTTGACGGTTGGAGGAAGGCTTTGACTACACTGTCCCGGATTTCCGGATGGCCTTTTAGCGAGAAAGA
ATCAGAGGCAAAACTAGTCGAAGATATAAGCACGGCAATACAAAAAAAGCTTAATAAAAATGTCCAGAAATTACCCGCACTGAAGCAAATTACTCATACC
CAATCGCCCACCAGCGGCCCGACAAAGTTAGCAACGTCCGCCGGTGCTAAAATTGCCAGCGGCCCAACTAAGTTAGCAACGGCATCCGGTGTTAAAAGTA
CAGTCGGCACTACAAAGTTAGCAATGTCGTCCGGTGTTAAAAACACTGTCGGTCACTCAAATTTTGGGTAG
AA sequence
>Lus10006929 pacid=23142124 polypeptide=Lus10006929 locus=Lus10006929.g ID=Lus10006929.BGIv1.0 annot-version=v1.0
MPLMRPSPPLPPPLPLLPLKYDVFLSFRGEDVRGRFVDHLYARLHTLKVNAFMDDKKLSRGKVIEDSILKAIERSRISVIVFSPGFADSDWCLDELVKIV
RCITSFGHVAIPIFFHVSPDDVAAQAGVYKKAFAQHAKVFTKQRVDGWRKALTTLSRISGWPFSEKESEAKLVEDISTAIQKKLNKNVQKLPALKQITHT
QSPTSGPTKLATSAGAKIASGPTKLATASGVKSTVGTTKLAMSSGVKNTVGHSNFG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G72890 Disease resistance protein (TI... Lus10006929 0 1
AT1G67940 ABCI17, AtSTAR1... ARABIDOPSIS THALIANA NON-INTRI... Lus10031069 1.7 0.9604
AT2G19130 S-locus lectin protein kinase ... Lus10042266 3.5 0.9561
AT4G21380 ARK3 receptor kinase 3 (.1) Lus10033365 4.2 0.9586
AT5G02390 DAU1 DUO1-activated unknown 1, Prot... Lus10040814 6.2 0.9436
AT4G27290 S-locus lectin protein kinase ... Lus10016871 6.7 0.9563
AT3G11340 UGT76B1 UDP-dependent glycosyltransfer... Lus10016461 8.4 0.9549
AT4G35160 O-methyltransferase family pro... Lus10013945 8.5 0.9408
AT2G40200 bHLH bHLH051 basic helix-loop-helix (bHLH) ... Lus10013917 9.0 0.9497
AT2G36950 Heavy metal transport/detoxifi... Lus10022617 9.6 0.9570
AT2G37050 Leucine-rich repeat protein ki... Lus10019237 9.9 0.9580

Lus10006929 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.