Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G20030 138 / 3e-42 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G06210 73 / 6e-17 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT3G46020 69 / 1e-15 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G23830 67 / 7e-15 AtGRP4, GR-RBP4, GRP4 glycine-rich RNA-binding protein 4 (.1.2) AT3G20930 69 / 3e-14 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G54580 62 / 1e-12 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G19030 59 / 3e-11 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT1G73530 59 / 4e-11 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G08695 58 / 2e-10 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G74230 57 / 3e-10 GR-RBP5 glycine-rich RNA-binding protein 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027035 [exp] 73 / 2e-15 AT3G20930 360 / 8e-123 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10014802 [exp] 65 / 8e-13 AT5G54580 176 / 2e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003593 [exp] 65 / 1e-12 AT5G54580 174 / 6e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10029426 [exp] 65 / 1e-12 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10031534 [exp] 62 / 1e-12 AT3G08000 146 / 2e-46 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10015146 [exp] 62 / 1e-12 AT3G08000 145 / 5e-46 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10018277 [exp] 62 / 9e-12 AT4G19610 770 / 0.0 nucleotide binding;nucleic acid binding;RNA binding (.1) Lus10040636 [exp] 62 / 1e-11 AT4G19610 700 / 0.0 nucleotide binding;nucleic acid binding;RNA binding (.1) Lus10037960 [exp] 61 / 2e-11 AT3G10400 240 / 2e-79 U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G074900 [exp] 141 / 2e-43 AT4G20030 164 / 2e-52 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.006G208500 [exp] 78 / 5e-19 AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.008G022280 [exp] 72 / 1e-16 AT3G20930 203 / 2e-65 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.009G160300 [exp] 70 / 4e-16 AT2G27330 98 / 1e-27 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.012G038200 [exp] 71 / 8e-16 AT1G73530 141 / 6e-43 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.008G022200 [exp] 70 / 2e-14 AT3G20930 427 / 3e-149 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.010G237200 [exp] 69 / 3e-14 AT3G20930 429 / 5e-150 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G319900 [exp] 64 / 2e-13 AT4G13850 140 / 1e-43 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.003G149600 [exp] 65 / 1e-12 AT4G19610 646 / 0.0 nucleotide binding;nucleic acid binding;RNA binding (.1) Potri.010G227500 [exp] 64 / 1e-12 AT3G10400 223 / 7e-73 U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [flax] [poplar] RRM PF00076 [flax] [poplar] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Lus10006936 pacid=23158099 polypeptide=Lus10006936 locus=Lus10006936.g ID=Lus10006936.BGIv1.0 annot-version=v1.0 ATGACCACAATACCCACTTCCTTGCCTTTCTCATCGCGCTTTCATCTTCAATTGAATCCTCGTCGTCTGGAGCTCCGCTTTGCCCCTGATTCTAATAGAT TATTTTTATTCAACGCCAGAGCTTCTCTGTCAACTACTCCCAGCTTTCCACTGGCCAGCCGAATCGTTGTGAAAAATTTACCCTTTTCAACCAATGAAAG CGATTTGCGACAAGAGTTCTCAAATTTTGGGGAAGTAGCTGAAGTTAAGCTTGTAAAGTATGAAGATAGGGAAAGACGTAATGCTTATGCATTCATCCAA TACACTTGCCTAGATGATGCCTTGCTTGCCTTGGAGAACATGGATGGCGAGGTGTTGGACGGGAGGATGATATATGTGGATGTTGCTAAACCTGGGAGGC GTTGTTTTGGAGCCTACCCAACAGCCTCTGGACCTCCACAACAATCCTCTGCATCTTTGAATGACCAAGATGAATGCTGGTACTGA
AA sequence Show only first row Show all	>Lus10006936 pacid=23158099 polypeptide=Lus10006936 locus=Lus10006936.g ID=Lus10006936.BGIv1.0 annot-version=v1.0 MTTIPTSLPFSSRFHLQLNPRRLELRFAPDSNRLFLFNARASLSTTPSFPLASRIVVKNLPFSTNESDLRQEFSNFGEVAEVKLVKYEDRERRNAYAFIQ YTCLDDALLALENMDGEVLDGRMIYVDVAKPGRRCFGAYPTASGPPQQSSASLNDQDECWY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G20030			RNA-binding (RRM/RBD/RNP motif...		Lus10006936 [exp]	0	1
AT1G13270		MAP1B, MAP1C	methionine aminopeptidase 1B (...		Lus10035045 [exp]	3.7	0.9034
AT1G55300		TAF7	TBP-associated factor 7 (.1.2)		Lus10021337 [exp]	4.2	0.8757
AT2G45770		FRD4, CPFTSY	FERRIC CHELATE REDUCTASE DEFEC...		Lus10036570 [exp]	4.5	0.8898
AT5G52100		CRR1	chlororespiration reduction 1,...		Lus10005771 [exp]	5.8	0.8656
AT5G24314		PDE225, PTAC7	PIGMENT DEFECTIVE 225, plastid...		Lus10041454 [exp]	7.4	0.8763
AT1G76760		ATY1, TRX-Y1	thioredoxin Y1 (.1)		Lus10018875 [exp]	12.1	0.8752
AT1G14270			CAAX amino terminal protease f...		Lus10037179 [exp]	12.6	0.8809
AT5G44650		Y3IP1, AtCEST	Ycf3-interacting protein 1, Ar...		Lus10038385 [exp]	13.4	0.8723
AT3G07670			Rubisco methyltransferase fami...		Lus10016087 [exp]	14.7	0.8579
AT5G08400			Protein of unknown function (D...		Lus10009625 [exp]	15.8	0.8271

Compare expression of checked genes

Lus10006936 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.