Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34930 196 / 3e-58 disease resistance family protein / LRR family protein (.1) AT2G15080 109 / 6e-28 AtRLP19 receptor like protein 19 (.1.2) AT1G71400 107 / 3e-27 AtRLP12 receptor like protein 12 (.1) AT3G11010 106 / 6e-27 AtRLP34 receptor like protein 34 (.1) AT5G40170 106 / 8e-27 AtRLP54 receptor like protein 54 (.1) AT3G05650 105 / 2e-26 AtRLP32 receptor like protein 32 (.1) AT1G47890 105 / 2e-26 AtRLP7 receptor like protein 7 (.1) AT2G15042 104 / 3e-26 Leucine-rich repeat (LRR) family protein (.1) AT3G05660 104 / 4e-26 AtRLP33 receptor like protein 33 (.1) AT5G44700 102 / 1e-25 GSO2, EDA23 GASSHO 2, EMBRYO SAC DEVELOPMENT ARREST 23, Leucine-rich repeat transmembrane protein kinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024737 [exp] 340 / 5e-112 AT2G34930 920 / 0.0 disease resistance family protein / LRR family protein (.1) Lus10006948 [exp] 163 / 7e-47 AT2G34930 637 / 0.0 disease resistance family protein / LRR family protein (.1) Lus10016342 [exp] 149 / 7e-42 AT2G34930 478 / 4e-154 disease resistance family protein / LRR family protein (.1) Lus10016339 [exp] 148 / 2e-41 AT2G34930 495 / 2e-160 disease resistance family protein / LRR family protein (.1) Lus10016341 [exp] 140 / 2e-38 AT2G34930 482 / 3e-155 disease resistance family protein / LRR family protein (.1) Lus10016326 [exp] 139 / 2e-38 AT2G34930 456 / 2e-145 disease resistance family protein / LRR family protein (.1) Lus10016337 [exp] 139 / 3e-38 AT2G34930 471 / 6e-151 disease resistance family protein / LRR family protein (.1) Lus10002753 [exp] 139 / 5e-38 AT2G34930 389 / 2e-120 disease resistance family protein / LRR family protein (.1) Lus10002743 [exp] 138 / 8e-38 AT2G34930 476 / 6e-153 disease resistance family protein / LRR family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G196766 [exp] 154 / 1e-44 AT2G34930 257 / 7e-76 disease resistance family protein / LRR family protein (.1) Potri.010G058850 [exp] 152 / 2e-43 AT2G01950 155 / 1e-39 VASCULAR HIGHWAY 1, BRI1-like 2 (.1) Potri.012G034600 [exp] 137 / 1e-37 AT2G34930 434 / 1e-137 disease resistance family protein / LRR family protein (.1) Potri.015G025200 [exp] 135 / 6e-37 AT2G34930 414 / 7e-130 disease resistance family protein / LRR family protein (.1) Potri.015G024600 [exp] 135 / 6e-37 AT2G34930 415 / 5e-130 disease resistance family protein / LRR family protein (.1) Potri.015G025800 [exp] 135 / 7e-37 AT2G34930 375 / 3e-115 disease resistance family protein / LRR family protein (.1) Potri.001G262800 [exp] 133 / 3e-36 AT2G34930 429 / 8e-135 disease resistance family protein / LRR family protein (.1) Potri.015G024800 [exp] 130 / 4e-35 AT2G34930 299 / 3e-86 disease resistance family protein / LRR family protein (.1) Potri.001G043800 [exp] 127 / 3e-34 AT2G34930 383 / 7e-119 disease resistance family protein / LRR family protein (.1) Potri.015G024500 [exp] 126 / 1e-33 AT2G34930 315 / 7e-92 disease resistance family protein / LRR family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Lus10006946 pacid=23158103 polypeptide=Lus10006946 locus=Lus10006946.g ID=Lus10006946.BGIv1.0 annot-version=v1.0 ATGGATCTTGGAGGGAACAGATTAACAGGGATCTTACCTGCCTGGATAGGGGAAAAGTTCCAATCCCTTTTTATGTTGAACCTGCAGTCAAACACTTTCA GCGGACCAGTCGCACCACTGTGCAGTCTTCCAAATCTTCACATCTTGGACATCTCTGGTAATAAGTTCTCAGGGGCTGTACCCAAGTCTCTGGGCAACCT GACAGCCATGGCAGCAGATAAGAGCGGTGATATCTTTGCACAACTACTAACAGTAGCAATGAAGGGGAGGAAGGTGGAGCTAGATAGCATTCTAGCAAAC ATCAACGCCATTAACCTATCTGGAAACAATCTGACTGGAGATATACCTGGTGACATCATAAACCTCTCTGCATTGAGAATCCTCAACCTGTCCAGAAATC AGCTGAGTGGGAAGATCCCAGAGAAGATTGGAGAGCTGCAGCATTTGGAAGCACTTGACCTGTCATACAACCATGTGATGGGTTCAATACCACAAAGCTT GGCTTCTATAGTTTCGTTGGTTCACTTGAACTTATCATACAACAGCTTGGAAGAATAA
AA sequence Show only first row Show all	>Lus10006946 pacid=23158103 polypeptide=Lus10006946 locus=Lus10006946.g ID=Lus10006946.BGIv1.0 annot-version=v1.0 MDLGGNRLTGILPAWIGEKFQSLFMLNLQSNTFSGPVAPLCSLPNLHILDISGNKFSGAVPKSLGNLTAMAADKSGDIFAQLLTVAMKGRKVELDSILAN INAINLSGNNLTGDIPGDIINLSALRILNLSRNQLSGKIPEKIGELQHLEALDLSYNHVMGSIPQSLASIVSLVHLNLSYNSLEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G34930			disease resistance family prot...		Lus10006946 [exp]	0	1
AT2G34930			disease resistance family prot...		Lus10006945 [exp]	4.2	0.8525
AT5G51890			Peroxidase superfamily protein...		Lus10031664 [exp]	10.5	0.8109
AT5G48540			receptor-like protein kinase-r...		Lus10025875 [exp]	14.1	0.8059
AT5G10530			Concanavalin A-like lectin pro...		Lus10033782 [exp]	14.3	0.7785
AT5G47430			DWNN domain, a CCHC-type zinc ...		Lus10029205 [exp]	15.0	0.7500
AT2G47190	MYB	AtMYB2	myb domain protein 2 (.1)		Lus10038062 [exp]	16.0	0.7789
AT2G44800			2-oxoglutarate (2OG) and Fe(II...		Lus10018949 [exp]	19.7	0.7704
AT4G23030			MATE efflux family protein (.1...		Lus10027417 [exp]	20.7	0.7770
AT5G51890			Peroxidase superfamily protein...		Lus10027405 [exp]	21.0	0.7885
AT2G19590		ATACO1, ACO1	ACC oxidase 1 (.1)		Lus10032683 [exp]	21.8	0.7746

Compare expression of checked genes

Lus10006946 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.