Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34930 63 / 1e-12 disease resistance family protein / LRR family protein (.1) AT1G47890 51 / 2e-08 AtRLP7 receptor like protein 7 (.1) AT3G05360 50 / 4e-08 AtRLP30 receptor like protein 30 (.1) AT3G20820 47 / 3e-07 Leucine-rich repeat (LRR) family protein (.1) AT5G23400 47 / 6e-07 Leucine-rich repeat (LRR) family protein (.1) AT2G26380 45 / 1e-06 Leucine-rich repeat (LRR) family protein (.1) AT4G13920 45 / 1e-06 AtRLP50 receptor like protein 50 (.1) AT4G13810 45 / 2e-06 AtRLP47 receptor like protein 47 (.1.2) AT1G71390 45 / 2e-06 AtRLP11 receptor like protein 11 (.1) AT4G13820 45 / 2e-06 Leucine-rich repeat (LRR) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002757 [exp] 71 / 9e-17 AT2G34930 103 / 1e-26 disease resistance family protein / LRR family protein (.1) Lus10024737 [exp] 75 / 1e-16 AT2G34930 920 / 0.0 disease resistance family protein / LRR family protein (.1) Lus10016384 [exp] 74 / 3e-16 AT2G34930 464 / 5e-148 disease resistance family protein / LRR family protein (.1) Lus10016340 [exp] 73 / 5e-16 AT2G34930 492 / 8e-159 disease resistance family protein / LRR family protein (.1) Lus10029483 [exp] 72 / 9e-16 AT2G34930 484 / 1e-155 disease resistance family protein / LRR family protein (.1) Lus10001035 [exp] 71 / 2e-15 AT2G34930 488 / 9e-157 disease resistance family protein / LRR family protein (.1) Lus10002753 [exp] 71 / 2e-15 AT2G34930 389 / 2e-120 disease resistance family protein / LRR family protein (.1) Lus10016341 [exp] 70 / 6e-15 AT2G34930 482 / 3e-155 disease resistance family protein / LRR family protein (.1) Lus10016338 [exp] 70 / 6e-15 AT2G34930 387 / 3e-121 disease resistance family protein / LRR family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G262800 [exp] 75 / 6e-17 AT2G34930 429 / 8e-135 disease resistance family protein / LRR family protein (.1) Potri.010G106900 [exp] 74 / 2e-16 AT2G34930 506 / 1e-164 disease resistance family protein / LRR family protein (.1) Potri.010G107000 [exp] 71 / 1e-15 AT2G34930 504 / 1e-163 disease resistance family protein / LRR family protein (.1) Potri.003G196832 [exp] 66 / 7e-14 AT2G34930 203 / 8e-57 disease resistance family protein / LRR family protein (.1) Potri.001G027500 [exp] 62 / 2e-12 AT2G34930 130 / 1e-33 disease resistance family protein / LRR family protein (.1) Potri.015G025200 [exp] 58 / 7e-11 AT2G34930 414 / 7e-130 disease resistance family protein / LRR family protein (.1) Potri.015G024600 [exp] 58 / 7e-11 AT2G34930 415 / 5e-130 disease resistance family protein / LRR family protein (.1) Potri.001G043800 [exp] 57 / 1e-10 AT2G34930 383 / 7e-119 disease resistance family protein / LRR family protein (.1) Potri.012G034600 [exp] 57 / 1e-10 AT2G34930 434 / 1e-137 disease resistance family protein / LRR family protein (.1) Potri.015G025300 [exp] 56 / 3e-10 AT2G34930 314 / 1e-91 disease resistance family protein / LRR family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08263 [flax] [poplar] LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10006947 pacid=23158094 polypeptide=Lus10006947 locus=Lus10006947.g ID=Lus10006947.BGIv1.0 annot-version=v1.0 ATGGATTGCAGAACAGCCTTCAACTTCCTCCTTCTCCACCTCTTCCTTGCCTATTTCATCAACTTCACTTCCTGCAATGGACAGCTCACAGTCAGATGCT TAAGATCTCAAAAAGATGCACTTTTAGCTTTCAAGGAGGGCCTCATTGATCCTTCTGGCCGCCTATCCTCTTGGGTTAGCAATGATTGCTGCAGCTGGGA AGGCATCGAGTGTGACAACCTAACGGGAACTGTAGTCAAGATTCATCTCCGGAACCCATTCCCAATCAGCGTCCAACCATATTCCATGACCACCGACAAT TGGAAGCCTACAAAATTTCATGCTTGGGAGGTCAGTTAG
AA sequence Show only first row Show all	>Lus10006947 pacid=23158094 polypeptide=Lus10006947 locus=Lus10006947.g ID=Lus10006947.BGIv1.0 annot-version=v1.0 MDCRTAFNFLLLHLFLAYFINFTSCNGQLTVRCLRSQKDALLAFKEGLIDPSGRLSSWVSNDCCSWEGIECDNLTGTVVKIHLRNPFPISVQPYSMTTDN WKPTKFHAWEVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G34930			disease resistance family prot...		Lus10006947 [exp]	0	1
AT1G03220			Eukaryotic aspartyl protease f...		Lus10021938 [exp]	6.6	0.8467
AT1G19230			Riboflavin synthase-like super...		Lus10034890 [exp]	12.0	0.8396
AT4G00710		BSK3	BR-signaling kinase 3 (.1)		Lus10030383 [exp]	13.3	0.8459
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10018721 [exp]	15.0	0.8099
AT5G05460		AtENGase85A	Endo-beta-N-acetyglucosaminida...		Lus10017430 [exp]	15.9	0.8242
AT3G50150			Plant protein of unknown funct...		Lus10010065 [exp]	16.1	0.8318
AT5G15290		CASP5	Casparian strip membrane domai...		Lus10015375 [exp]	18.5	0.8317
AT2G26690			Major facilitator superfamily ...		Lus10030081 [exp]	21.0	0.7649
AT1G04040			HAD superfamily, subfamily III...		Lus10011774 [exp]	21.2	0.8366
AT5G14020			Endosomal targeting BRO1-like ...		Lus10035167 [exp]	22.2	0.8345

Compare expression of checked genes

Lus10006947 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.