Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18910 117 / 6e-35 hydroxyproline-rich glycoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025469 [exp] 177 / 3e-58 AT2G18910 135 / 8e-42 hydroxyproline-rich glycoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G090900 [exp] 137 / 1e-42 AT2G18910 136 / 4e-42 hydroxyproline-rich glycoprotein family protein (.1) Potri.006G166400 [exp] 124 / 2e-37 AT2G18910 125 / 1e-37 hydroxyproline-rich glycoprotein family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006958 pacid=23165441 polypeptide=Lus10006958 locus=Lus10006958.g ID=Lus10006958.BGIv1.0 annot-version=v1.0 ATGCCAATCAACGCCGACCCATCAACTCCGCCGCCGACCATCGGCAAAATCGGACCGTACACAGTCTTCATCACTCCTCCTCCAACTCCCACCGCCGCCG CCACAACTCCGCCGCCGCAGCCTCCTTCACCCATCTACGACACTCCAAAGAAGGTGGTTTGCCCTCCAGCTCCCCAGATCCACCCCTCCAACCTTCCTCA CGCCGACGGCGACTCCTCCGTCCTTGGCTTCCTACGCACCGCCGTGACCAAGGTTCAACACGTGAATTCGAGCTTGGATGATCATTTGGCGAGGTGGTTT GGATTGAATCAGTCAAAGTACCAGTGGGCTCTTGATGATTATCTTGAGACCAAAGGATTGGTAACTAACAACCCTCTTTACCATTCTGCTTAG
AA sequence Show only first row Show all	>Lus10006958 pacid=23165441 polypeptide=Lus10006958 locus=Lus10006958.g ID=Lus10006958.BGIv1.0 annot-version=v1.0 MPINADPSTPPPTIGKIGPYTVFITPPPTPTAAATTPPPQPPSPIYDTPKKVVCPPAPQIHPSNLPHADGDSSVLGFLRTAVTKVQHVNSSLDDHLARWF GLNQSKYQWALDDYLETKGLVTNNPLYHSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G18910			hydroxyproline-rich glycoprote...		Lus10006958 [exp]	0	1
AT2G18910			hydroxyproline-rich glycoprote...		Lus10025469 [exp]	1.0	0.8788
AT5G17210			Protein of unknown function (D...		Lus10010077 [exp]	3.2	0.8537
AT2G20820			unknown protein		Lus10033715 [exp]	9.8	0.8393
AT4G16490			ARM repeat superfamily protein...		Lus10038811 [exp]	9.8	0.8243
					Lus10034878 [exp]	10.4	0.8094
AT1G06475			unknown protein		Lus10020752 [exp]	12.4	0.8124
AT4G11090		TBL23	TRICHOME BIREFRINGENCE-LIKE 23...		Lus10032367 [exp]	14.0	0.8298
AT3G57400			unknown protein		Lus10018074 [exp]	14.9	0.7926
AT1G32860			Glycosyl hydrolase superfamily...		Lus10017344 [exp]	15.5	0.8225
AT4G33640			unknown protein		Lus10020463 [exp]	16.9	0.8088

Compare expression of checked genes

Lus10006958 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.