Lus10006967 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G57480 202 / 4e-63 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT4G25835 199 / 7e-62 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT4G30250 178 / 7e-54 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G28580 52 / 5e-08 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G28510 44 / 2e-05 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015354 59 / 1e-10 AT5G40010 598 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Lus10015802 47 / 2e-06 AT3G50940 462 / 9e-161 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10041918 45 / 1e-05 AT3G50930 383 / 2e-126 cytochrome BC1 synthesis (.1)
Lus10015349 42 / 0.0001 AT5G40010 536 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Lus10037004 42 / 0.0002 AT3G50930 457 / 9e-159 cytochrome BC1 synthesis (.1)
Lus10030667 40 / 0.0004 AT5G40010 501 / 2e-174 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G169000 202 / 4e-63 AT5G57480 776 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.018G093600 198 / 1e-61 AT5G57480 743 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.001G231200 51 / 8e-08 AT4G25835 359 / 1e-118 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.009G024400 50 / 1e-07 AT4G25835 362 / 4e-120 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.013G047900 47 / 2e-06 AT5G40010 537 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Potri.004G012500 46 / 4e-06 AT5G40010 556 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Potri.009G119132 46 / 4e-06 AT3G50930 484 / 3e-166 cytochrome BC1 synthesis (.1)
Potri.004G091500 46 / 4e-06 AT5G40010 582 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Potri.019G020700 46 / 5e-06 AT5G40010 531 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Potri.019G020800 45 / 7e-06 AT5G40010 526 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
PFAM info
Representative CDS sequence
>Lus10006967 pacid=23165433 polypeptide=Lus10006967 locus=Lus10006967.g ID=Lus10006967.BGIv1.0 annot-version=v1.0
ATGAAGGAGTACTGGACCTCTCTGGCCTCCCTCCTCGGCGTCCTCGCCTTCTGCCAGAGCCTCCTCCTCTCCCTCTTCCCGCCGGAGCTCCGCTTCGCCT
TCCTCAACCTCACCTCCCGCCTCTTCTCCACCCTCTTCTCCTCCTCCTACCTCTACTTCGACATCACCGAGATCGACGGCGTCAACACCAACGAGCTCTA
CAACGCCGTCCAGCTTTACCTCACCTCCTCCGTCTCCTCCTCTCTCCCTTCCCGCCTCTCCCTCACCCGCTCGCCCAACTCCTCCGCCGTCACCTTCGGC
CTCGCCAACAACGACTCCATCTCCGACTCCTTCAACGGCGTCCCCCTCCTCTGGGAGCACGTCGTCACCCAGCGCAACTCCCAGTCCTTCTCCTGGCGCC
CCTTACCGGACGAAAAGCGAGGATTCACTCTTCGGATTCGAAAAAAAGATAAATCCTTAGTCCTCGATTCGTACATCGATTACATTATGGATCCCGCCCG
NATGTGCGGGGCGCCTGAGATGTAA
AA sequence
>Lus10006967 pacid=23165433 polypeptide=Lus10006967 locus=Lus10006967.g ID=Lus10006967.BGIv1.0 annot-version=v1.0
MKEYWTSLASLLGVLAFCQSLLLSLFPPELRFAFLNLTSRLFSTLFSSSYLYFDITEIDGVNTNELYNAVQLYLTSSVSSSLPSRLSLTRSPNSSAVTFG
LANNDSISDSFNGVPLLWEHVVTQRNSQSFSWRPLPDEKRGFTLRIRKKDKSLVLDSYIDYIMDPAXMCGAPEM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G57480 P-loop containing nucleoside t... Lus10006967 0 1
AT5G57480 P-loop containing nucleoside t... Lus10006968 1.0 0.9505
AT5G57480 P-loop containing nucleoside t... Lus10025479 1.4 0.8965
AT3G15630 unknown protein Lus10017768 6.0 0.7532
AT1G01730 unknown protein Lus10030384 17.1 0.7656
AT5G62350 Plant invertase/pectin methyle... Lus10038914 18.0 0.7471
AT3G02645 Plant protein of unknown funct... Lus10026964 20.6 0.7527
AT1G70300 KUP6 K+ uptake permease 6, K+ uptak... Lus10012992 21.4 0.6956
AT3G50530 CRK CDPK-related kinase (.1.2) Lus10009342 21.6 0.7503
AT4G37650 GRAS SGR7, SHR SHORT ROOT, SHOOT GRAVITROPISM... Lus10019281 23.6 0.7273
AT1G78700 BZR BEH4 BES1/BZR1 homolog 4 (.1) Lus10007319 26.3 0.6876

Lus10006967 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.