Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25780 235 / 2e-79 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G57625 166 / 5e-52 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 160 / 8e-50 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT1G01310 158 / 1e-48 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G30320 147 / 2e-45 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G31470 142 / 5e-43 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 136 / 5e-41 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33720 134 / 5e-40 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G26130 131 / 5e-39 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G02730 129 / 7e-38 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005557 [exp] 160 / 3e-50 AT4G31470 199 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10013693 [exp] 159 / 1e-49 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006980 [exp] 155 / 4e-48 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10001319 [exp] 154 / 1e-47 AT4G30320 201 / 6e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10011318 [exp] 152 / 5e-47 AT4G31470 164 / 1e-51 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10019993 [exp] 151 / 4e-46 AT4G30320 197 / 7e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10015522 [exp] 149 / 1e-45 AT4G30320 199 / 7e-66 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10025697 [exp] 131 / 7e-39 AT1G50060 213 / 1e-71 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10020491 [exp] 128 / 9e-38 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G096028 [exp] 275 / 2e-94 AT4G25780 219 / 3e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096007 [exp] 167 / 3e-53 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G171300 [exp] 149 / 7e-46 AT4G30320 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083100 [exp] 145 / 1e-44 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083300 [exp] 144 / 3e-44 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.018G007000 [exp] 144 / 7e-44 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083000 [exp] 138 / 8e-42 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083600 [exp] 128 / 5e-38 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082900 [exp] 122 / 3e-35 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.001G288600 [exp] 117 / 2e-33 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10006981 pacid=23165439 polypeptide=Lus10006981 locus=Lus10006981.g ID=Lus10006981.BGIv1.0 annot-version=v1.0 ATGAAACCCCAAATTCTCTTCACCCTATTCATAATTCCTTACTTCTCCACCATTTTCCTCATAGTAGCCGCCGGAATCCCATCACTGACCCCGTCGGAGC CGAACGGCACCGTTTACAAGGTCTCGAAGCAACTCTGTTGGGGATGCGCAGGGGAGTCCTTGGAGTTCCTCTTCTACCACAACTTGATCCGCACTTCCAA ATGGGAGCTCCCTTTAGTTTGGGATTTCCAGCTCGAGAACTATGCAAGGTGGTGGGCCGGCCAGCGGAAATCGGACTGCCGGCTGGAGCATTCATTCCCG GAAGGTGATTTCAAGCTAGGGGAGAACATATACTGGGGGAGCGGCGGAGCGTGGCGCCCACTTGACGCAGTGCGCGCGTGGGCAGAGGAGGAGAAGTACT ACGATTACGCAGCGAACAGCTGCGAGGCGGGGCAAATGTGCGGCCACTATACGCAGATCGTGTGGAGGAAGACGACACGCCTTGGGTGCGCTCGTGTGGT TTGTGACGACGGGGATGTGTTCATGACTTGTAATTACGATCCTCCTGGGAATTATGATGGGGAGAGGCCGTATTAG
AA sequence Show only first row Show all	>Lus10006981 pacid=23165439 polypeptide=Lus10006981 locus=Lus10006981.g ID=Lus10006981.BGIv1.0 annot-version=v1.0 MKPQILFTLFIIPYFSTIFLIVAAGIPSLTPSEPNGTVYKVSKQLCWGCAGESLEFLFYHNLIRTSKWELPLVWDFQLENYARWWAGQRKSDCRLEHSFP EGDFKLGENIYWGSGGAWRPLDAVRAWAEEEKYYDYAANSCEAGQMCGHYTQIVWRKTTRLGCARVVCDDGDVFMTCNYDPPGNYDGERPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25780			CAP (Cysteine-rich secretory p...		Lus10006981 [exp]	0	1
AT5G02380		MT2B	metallothionein 2B (.1)		Lus10024396 [exp]	4.5	0.7387
AT3G16300			Uncharacterised protein family...		Lus10038271 [exp]	4.9	0.7371
AT5G05610	Alfin	AL1	alfin-like 1 (.1.2)		Lus10009889 [exp]	5.7	0.7647
AT1G72020			unknown protein		Lus10009443 [exp]	10.9	0.7308
AT5G28830			calcium-binding EF hand family...		Lus10015916 [exp]	12.4	0.7478
AT1G07070			Ribosomal protein L35Ae family...		Lus10021121 [exp]	18.1	0.7611
AT5G65520			Tetratricopeptide repeat (TPR)...		Lus10025714 [exp]	22.5	0.7385
AT5G42630	GARP	KAN4, KANADI4, ...	KANADI 4, ABERRANT TESTA SHAPE...		Lus10011660 [exp]	24.7	0.7262
AT3G19850			Phototropic-responsive NPH3 fa...		Lus10034200 [exp]	27.8	0.7488
AT5G55940		EMB2731	embryo defective 2731, Unchara...		Lus10016647 [exp]	30.4	0.6777

Compare expression of checked genes

Lus10006981 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.