Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12400 110 / 1e-33 Nucleotide excision repair, TFIIH, subunit TTDA (.1) AT1G62886 89 / 4e-25 Nucleotide excision repair, TFIIH, subunit TTDA (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007001 [exp] 144 / 3e-47 AT1G12400 111 / 3e-34 Nucleotide excision repair, TFIIH, subunit TTDA (.1) Lus10000383 [exp] 144 / 3e-47 AT1G12400 111 / 3e-34 Nucleotide excision repair, TFIIH, subunit TTDA (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G116000 [exp] 117 / 2e-36 AT1G12400 124 / 2e-39 Nucleotide excision repair, TFIIH, subunit TTDA (.1) Potri.009G138800 [exp] 103 / 3e-31 AT1G12400 115 / 5e-36 Nucleotide excision repair, TFIIH, subunit TTDA (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06331 [flax] [poplar] Tfb5 Transcription factor TFIIH complex subunit Tfb5
Representative CDS sequence Show only first row Show all	>Lus10006998 pacid=23168943 polypeptide=Lus10006998 locus=Lus10006998.g ID=Lus10006998.BGIv1.0 annot-version=v1.0 ATGGTGAATGCAACCAAAGGAGTGTTCATTACTTGTGACATACCCATGGCGCAACTCATTATCAACTTTAATGCTTCCCAACCTGCATCACAGAAGTTCA TCATTCATGTTCTGGATAGCACCCATCTGTTCGTGCAGCCCTACGCAATCGACATGATCAAATCCCACATTACAGAGTTCAGAGACCAGATTTCCTATGA GAAGCCTACTTGA
AA sequence Show only first row Show all	>Lus10006998 pacid=23168943 polypeptide=Lus10006998 locus=Lus10006998.g ID=Lus10006998.BGIv1.0 annot-version=v1.0 MVNATKGVFITCDIPMAQLIINFNASQPASQKFIIHVLDSTHLFVQPYAIDMIKSHITEFRDQISYEKPT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G12400			Nucleotide excision repair, TF...		Lus10006998 [exp]	0	1
AT3G19460			Reticulon family protein (.1.2...		Lus10019812 [exp]	1.4	0.8895
AT2G17570			Undecaprenyl pyrophosphate syn...		Lus10002788 [exp]	4.5	0.8606
AT3G26980		MUB4	membrane-anchored ubiquitin-fo...		Lus10035184 [exp]	5.1	0.8844
AT2G25280			unknown protein		Lus10001950 [exp]	13.0	0.8719
AT2G02970			GDA1/CD39 nucleoside phosphata...		Lus10012825 [exp]	13.2	0.8664
AT5G11970			Protein of unknown function (D...		Lus10017155 [exp]	13.6	0.8816
AT4G10100		CNX7, SIR5	"co-factor for nitrate, reduct...		Lus10041075 [exp]	16.2	0.8672
AT1G23750			Nucleic acid-binding, OB-fold-...		Lus10029155 [exp]	17.7	0.8473
AT1G14300			ARM repeat superfamily protein...		Lus10036742 [exp]	24.3	0.8396
AT3G15352		ATCOX17	ARABIDOPSIS THALIANA CYTOCHROM...		Lus10037356 [exp]	24.5	0.8585

Compare expression of checked genes

Lus10006998 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.