Lus10007001 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G12400 111 / 3e-34 Nucleotide excision repair, TFIIH, subunit TTDA (.1)
AT1G62886 91 / 7e-26 Nucleotide excision repair, TFIIH, subunit TTDA (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000383 146 / 5e-48 AT1G12400 111 / 3e-34 Nucleotide excision repair, TFIIH, subunit TTDA (.1)
Lus10006998 144 / 3e-47 AT1G12400 110 / 8e-34 Nucleotide excision repair, TFIIH, subunit TTDA (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G116000 119 / 3e-37 AT1G12400 124 / 2e-39 Nucleotide excision repair, TFIIH, subunit TTDA (.1)
Potri.009G138800 105 / 5e-32 AT1G12400 115 / 5e-36 Nucleotide excision repair, TFIIH, subunit TTDA (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06331 Tfb5 Transcription factor TFIIH complex subunit Tfb5
Representative CDS sequence
>Lus10007001 pacid=23168969 polypeptide=Lus10007001 locus=Lus10007001.g ID=Lus10007001.BGIv1.0 annot-version=v1.0
ATGGTGAATGCAACCAAAGGAGTGTTCATTACTTGTGATATACCCATGGCGCAACTCATTATCAACCTTAACGCTTCCCAACCTGCATCACAGAAGTTCA
TCATTCATGTTCTGGATAGCACCCATCTCTTCGTGCAGCCCTACGCAATCGATATGATCAAATCCCACATTACAGAGTTCAGAGACCAGATTTCCTATGA
GAAGCCTACTTGA
AA sequence
>Lus10007001 pacid=23168969 polypeptide=Lus10007001 locus=Lus10007001.g ID=Lus10007001.BGIv1.0 annot-version=v1.0
MVNATKGVFITCDIPMAQLIINLNASQPASQKFIIHVLDSTHLFVQPYAIDMIKSHITEFRDQISYEKPT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G12400 Nucleotide excision repair, TF... Lus10007001 0 1
AT4G14455 ATBS14B ,ATBET1... ARABIDOPSIS THALIANA BET1P/SFT... Lus10021879 1.7 0.7162
AT2G38280 ATAMPD, FAC1 EMBRYONIC FACTOR1, ADENOSINE 5... Lus10005043 5.1 0.7333
AT1G05780 Vacuolar ATPase assembly integ... Lus10018982 6.9 0.6826
AT3G61350 SKIP4 SKP1 interacting partner 4 (.1... Lus10017821 11.8 0.7231
AT2G25830 YebC-related (.1) Lus10038722 13.4 0.6708
AT5G09225 unknown protein Lus10020870 19.2 0.7098
AT3G57360 unknown protein Lus10032322 23.1 0.6601
AT1G61700 RNA polymerases N / 8 kDa subu... Lus10025907 25.9 0.6951
AT3G54860 ATVPS33 VACUOLAR PROTEIN SORTING 33, S... Lus10007300 28.5 0.6707
AT1G17350 NADH:ubiquinone oxidoreductase... Lus10035323 29.3 0.5082

Lus10007001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.