Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45430 40 / 6e-05 AT-hook AHL22 AT-hook motif nuclear-localized protein 22 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006664 [exp] 62 / 4e-13 AT2G45430 178 / 2e-55 AT-hook motif nuclear-localized protein 22 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G116900 [exp] 49 / 5e-08 AT4G22810 258 / 5e-85 Predicted AT-hook DNA-binding family protein (.1) Potri.001G115200 [exp] 49 / 6e-08 AT4G22810 254 / 1e-83 Predicted AT-hook DNA-binding family protein (.1) Potri.002G149300 [exp] 43 / 8e-06 AT2G45430 226 / 1e-72 AT-hook motif nuclear-localized protein 22 (.1) Potri.014G070800 [exp] 42 / 1e-05 AT2G45430 222 / 5e-71 AT-hook motif nuclear-localized protein 22 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007007 pacid=23168979 polypeptide=Lus10007007 locus=Lus10007007.g ID=Lus10007007.BGIv1.0 annot-version=v1.0 ATGGCGGCGTCGTTTAGCAATGCGGCGTACGAGCGGCTGCCTTTGGAAGAGGAGGAGCCGCCGCAGATGGCGGCGGCAGGACAAGGCGGAATCGGCTCTC CGGGAGGAGGAGTGGGGTCCACCACCCCAAGTCAACAGCAGCAGCAACAACAGCAGCAGGTCATGGGTAGTGGAACCGGGTCGGGCGACCCGAATGGAGC TCCGCTTTTCCACGGGTTGCCGCCGAACTTGCTGAATTCAATCCAATTGCCTGCGGATGCTTACTGGGGCGGCGGAAACGGTAGCGGCGGCGGTGGAGGA CGTGCTCCTTACTGA
AA sequence Show only first row Show all	>Lus10007007 pacid=23168979 polypeptide=Lus10007007 locus=Lus10007007.g ID=Lus10007007.BGIv1.0 annot-version=v1.0 MAASFSNAAYERLPLEEEEPPQMAAAGQGGIGSPGGGVGSTTPSQQQQQQQQQVMGSGTGSGDPNGAPLFHGLPPNLLNSIQLPADAYWGGGNGSGGGGG RAPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45430	AT-hook	AHL22	AT-hook motif nuclear-localize...		Lus10007007 [exp]	0	1
AT4G25320	AT-hook		AT hook motif DNA-binding fami...		Lus10031118 [exp]	1.4	0.9740
AT5G63090	AS2	LOBB, LOB	Lateral organ boundaries (LOB)...		Lus10001139 [exp]	2.6	0.9590
AT2G45430	AT-hook	AHL22	AT-hook motif nuclear-localize...		Lus10006664 [exp]	3.5	0.9682
AT3G15730		PLDALPHA1	phospholipase D alpha 1 (.1)		Lus10039806 [exp]	3.5	0.9727
AT4G21105			cytochrome-c oxidases;electron...		Lus10006275 [exp]	3.9	0.9518
AT1G76370			Protein kinase superfamily pro...		Lus10007041 [exp]	4.2	0.9494
AT3G17970		ATTOC64-III	translocon at the outer membra...		Lus10018004 [exp]	4.5	0.9491
AT3G15730		PLDALPHA1	phospholipase D alpha 1 (.1)		Lus10018575 [exp]	5.7	0.9604
AT3G09270		ATGSTU8	glutathione S-transferase TAU ...		Lus10021103 [exp]	5.8	0.9494
AT2G18410			unknown protein		Lus10028481 [exp]	6.6	0.9382

Compare expression of checked genes

Lus10007007 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.