Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59110 56 / 7e-11 subtilisin-like serine protease-related (.1) AT5G58820 56 / 2e-10 Subtilisin-like serine endopeptidase family protein (.1) AT5G59130 53 / 2e-09 Subtilase family protein (.1.2) AT5G59090 52 / 4e-09 ATSBT4.12 subtilase 4.12 (.1.2.3) AT4G15040 51 / 9e-09 Subtilisin-like serine endopeptidase family protein (.1) AT5G59120 50 / 1e-08 ATSBT4.13 subtilase 4.13 (.1) AT5G58830 50 / 2e-08 Subtilisin-like serine endopeptidase family protein (.1) AT4G00230 50 / 2e-08 XSP1 xylem serine peptidase 1 (.1) AT1G32970 49 / 3e-08 Subtilisin-like serine endopeptidase family protein (.1) AT4G10520 49 / 5e-08 Subtilase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006700 [exp] 134 / 5e-41 AT5G67360 140 / 3e-38 Subtilase family protein (.1) Lus10006306 [exp] 81 / 2e-19 AT5G67360 555 / 0.0 Subtilase family protein (.1) Lus10029570 [exp] 77 / 9e-18 AT5G67360 550 / 0.0 Subtilase family protein (.1) Lus10029575 [exp] 76 / 2e-17 AT5G67360 552 / 0.0 Subtilase family protein (.1) Lus10028895 [exp] 74 / 5e-17 AT5G67360 566 / 0.0 Subtilase family protein (.1) Lus10002244 [exp] 74 / 6e-17 AT5G67360 567 / 0.0 Subtilase family protein (.1) Lus10008919 [exp] 72 / 3e-16 AT5G67360 561 / 0.0 Subtilase family protein (.1) Lus10006303 [exp] 70 / 2e-15 AT5G67360 563 / 0.0 Subtilase family protein (.1) Lus10002242 [exp] 68 / 1e-14 AT5G67360 555 / 0.0 Subtilase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G006570 [exp] 87 / 3e-21 AT1G04110 568 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.001G113700 [exp] 82 / 1e-19 AT1G04110 538 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.003G118500 [exp] 80 / 7e-19 AT1G04110 557 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.003G118800 [exp] 67 / 2e-14 AT1G04110 585 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.003G118700 [exp] 65 / 9e-14 AT1G04110 585 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.003G189200 [exp] 54 / 1e-09 AT1G20160 583 / 0.0 Subtilisin-like serine endopeptidase family protein (.1.2) Potri.002G151900 [exp] 48 / 1e-07 AT4G00230 938 / 0.0 xylem serine peptidase 1 (.1) Potri.009G145600 [exp] 47 / 2e-07 AT5G03620 615 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.014G026600 [exp] 47 / 2e-07 AT5G67360 546 / 0.0 Subtilase family protein (.1) Potri.014G074500 [exp] 47 / 2e-07 AT4G00230 790 / 0.0 xylem serine peptidase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007042 pacid=23168952 polypeptide=Lus10007042 locus=Lus10007042.g ID=Lus10007042.BGIv1.0 annot-version=v1.0 ATGAGCTCGACACGACAAACTTACACCCGGACAGTGACAAATGTAGGACCTGCTAATTCGTCGTGCAAGTCTGAAATCCTTGGACTACAAGGGGTTGACG TCAAGGTAACACCTGCAACAATTGCGTTCATTGAGCTGAACGAGAAGGTAAGCTTTTCAGTGGCATTCAGCAGAAAGGAAAGCTTCGCTGGACCTTCAAC TGAAGGCCATCTCAGGTGGTTTTCCAGTAACCACAACGATACAAGCCTGATTACTGTTAAGCTTGAGTTTCAGTAA
AA sequence Show only first row Show all	>Lus10007042 pacid=23168952 polypeptide=Lus10007042 locus=Lus10007042.g ID=Lus10007042.BGIv1.0 annot-version=v1.0 MSSTRQTYTRTVTNVGPANSSCKSEILGLQGVDVKVTPATIAFIELNEKVSFSVAFSRKESFAGPSTEGHLRWFSSNHNDTSLITVKLEFQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G58820			Subtilisin-like serine endopep...		Lus10007042 [exp]	0	1
AT4G37380			Tetratricopeptide repeat (TPR)...		Lus10026650 [exp]	1.7	0.7843
AT1G72740	MYB		Homeodomain-like/winged-helix ...		Lus10027621 [exp]	2.4	0.7627
AT3G02100			UDP-Glycosyltransferase superf...		Lus10040533 [exp]	20.1	0.6948
AT5G03720	HSF	AT-HSFA3	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10023866 [exp]	22.4	0.7387
AT1G65910	NAC	ANAC028	NAC domain containing protein ...		Lus10010959 [exp]	31.4	0.7138
AT5G51460		ATTPPA	Haloacid dehalogenase-like hyd...		Lus10031723 [exp]	32.5	0.7240
AT1G14790		ATRDRP1, RDR1	RNA-dependent RNA polymerase 1...		Lus10034391 [exp]	35.6	0.7302
AT1G27170			transmembrane receptors;ATP bi...		Lus10020524 [exp]	44.9	0.7069
AT5G44510		TAO1	target of AVRB operation1 (.1)		Lus10001537 [exp]	48.9	0.7080
AT5G03720	HSF	AT-HSFA3	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10014369 [exp]	51.4	0.7035

Compare expression of checked genes

Lus10007042 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.