Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47710 214 / 3e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 116 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT5G49050 109 / 4e-31 unknown protein AT1G09740 102 / 5e-28 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G62550 96 / 1e-25 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G58450 91 / 3e-23 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G68300 83 / 1e-20 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G11360 76 / 5e-17 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G53990 56 / 2e-10 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G17020 55 / 6e-10 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006701 [exp] 321 / 2e-114 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10006703 [exp] 265 / 1e-92 AT2G47710 169 / 1e-54 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 109 / 6e-31 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029850 [exp] 111 / 1e-30 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10034337 [exp] 107 / 3e-30 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 107 / 3e-27 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10009272 [exp] 96 / 3e-25 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029310 [exp] 87 / 1e-21 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10025033 [exp] 79 / 2e-18 AT3G62550 186 / 1e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G130100 [exp] 249 / 4e-86 AT2G47710 234 / 4e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G205275 [exp] 228 / 1e-77 AT2G47710 226 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G193800 [exp] 215 / 2e-72 AT2G47710 213 / 1e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G221300 [exp] 188 / 2e-61 AT2G47710 199 / 2e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G009800 [exp] 113 / 3e-32 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121900 [exp] 108 / 2e-30 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123200 [exp] 105 / 2e-29 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 104 / 1e-28 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.006G198200 [exp] 103 / 6e-28 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.010G123400 [exp] 100 / 5e-27 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10007043 pacid=23168949 polypeptide=Lus10007043 locus=Lus10007043.g ID=Lus10007043.BGIv1.0 annot-version=v1.0 ATGGCGGCTGAGAAGCAAGTGATGGTGGTTGGGATCGACGACAGCGAGCACAGCATGTACGCGCTGCAATGGACGCTCGACCATTTCTTCACTCCTTCCT CCGGCGACCTCTTCAAGCTCGTCGTCGTCCACTCCAAACCCACCCCTTCCTCCGTCGTCGGTCTCGCTGGTCCCGGCGCCGCTGAGGTTTTCCCGATCGT CGACTCCGACTTGAAGAAGATCGCCGCTAGGGTTCTTGACAAGACCAAGTCCATTTGCAGTAGTCATCAATCGGTGAAAGATGCGGTATATGAAGTAGTG GAAGGCGATGCTAGGAATGTACTCTGTGAAGCTGTAGAGAGGCACGGAGCTTCCATCCTGGTTGGGGGTAGCCATGGATATGGAACCCTCAAAAGGGCGG TTTTAGGTAGCGTGAGTGACTACTGTGCTCATCATGCTCACTGCACTGTCATGATTGTTAAGAAACCTAAGGCCAAACATTGA
AA sequence Show only first row Show all	>Lus10007043 pacid=23168949 polypeptide=Lus10007043 locus=Lus10007043.g ID=Lus10007043.BGIv1.0 annot-version=v1.0 MAAEKQVMVVGIDDSEHSMYALQWTLDHFFTPSSGDLFKLVVVHSKPTPSSVVGLAGPGAAEVFPIVDSDLKKIAARVLDKTKSICSSHQSVKDAVYEVV EGDARNVLCEAVERHGASILVGGSHGYGTLKRAVLGSVSDYCAHHAHCTVMIVKKPKAKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G47710			Adenine nucleotide alpha hydro...		Lus10007043 [exp]	0	1
AT2G47710			Adenine nucleotide alpha hydro...		Lus10006703 [exp]	1.4	0.9669
AT3G62550			Adenine nucleotide alpha hydro...		Lus10025033 [exp]	6.3	0.9123
AT1G68320	MYB	BW62C, BW62B, A...	myb domain protein 62 (.1)		Lus10009037 [exp]	10.8	0.9357
AT5G22390			Protein of unknown function (D...		Lus10020626 [exp]	11.2	0.9019
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Lus10011606 [exp]	13.9	0.8968
AT2G47710			Adenine nucleotide alpha hydro...		Lus10006701 [exp]	14.1	0.9460
AT5G65140		TPPJ	trehalose-6-phosphate phosphat...		Lus10000687 [exp]	14.8	0.9015
AT1G71695			Peroxidase superfamily protein...		Lus10028735 [exp]	23.6	0.9270
AT1G18390			Protein kinase superfamily pro...		Lus10029132 [exp]	25.8	0.8872
AT2G01080			Late embryogenesis abundant (L...		Lus10005728 [exp]	39.7	0.8734

Compare expression of checked genes

Lus10007043 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.