Lus10007050 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64120 215 / 5e-69 Peroxidase superfamily protein (.1)
AT2G41480 213 / 8e-68 Peroxidase superfamily protein (.1)
AT5G39580 205 / 4e-65 Peroxidase superfamily protein (.1.2)
AT5G64110 203 / 2e-64 Peroxidase superfamily protein (.1)
AT5G64100 178 / 1e-54 Peroxidase superfamily protein (.1)
AT4G25980 166 / 3e-49 Peroxidase superfamily protein (.1)
AT5G19880 156 / 5e-46 Peroxidase superfamily protein (.1)
AT1G77100 151 / 5e-44 Peroxidase superfamily protein (.1)
AT4G36430 144 / 2e-41 Peroxidase superfamily protein (.1)
AT5G06720 143 / 7e-41 ATPA2 peroxidase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020421 434 / 2e-156 AT2G41480 266 / 9e-89 Peroxidase superfamily protein (.1)
Lus10007051 380 / 1e-133 AT2G41480 403 / 1e-141 Peroxidase superfamily protein (.1)
Lus10007052 370 / 5e-130 AT2G41480 400 / 1e-140 Peroxidase superfamily protein (.1)
Lus10020422 322 / 2e-111 AT2G41480 252 / 7e-83 Peroxidase superfamily protein (.1)
Lus10012684 214 / 2e-68 AT2G41480 395 / 2e-138 Peroxidase superfamily protein (.1)
Lus10020826 196 / 3e-61 AT2G41480 375 / 1e-130 Peroxidase superfamily protein (.1)
Lus10015555 181 / 2e-55 AT2G41480 432 / 9e-153 Peroxidase superfamily protein (.1)
Lus10041784 141 / 3e-40 AT5G66390 519 / 0.0 Peroxidase superfamily protein (.1)
Lus10010634 140 / 9e-40 AT1G44970 449 / 5e-159 Peroxidase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G125000 264 / 3e-88 AT2G41480 419 / 7e-148 Peroxidase superfamily protein (.1)
Potri.006G069600 203 / 2e-64 AT2G41480 498 / 6e-179 Peroxidase superfamily protein (.1)
Potri.018G131600 189 / 5e-59 AT2G41480 478 / 4e-171 Peroxidase superfamily protein (.1)
Potri.007G019300 145 / 8e-42 AT5G66390 507 / 0.0 Peroxidase superfamily protein (.1)
Potri.005G118700 145 / 1e-41 AT5G66390 504 / 0.0 Peroxidase superfamily protein (.1)
Potri.011G027300 141 / 3e-40 AT3G01190 407 / 2e-143 Peroxidase superfamily protein (.1)
Potri.004G023100 139 / 2e-39 AT3G01190 403 / 1e-141 Peroxidase superfamily protein (.1)
Potri.004G023200 138 / 3e-39 AT3G01190 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.019G063201 138 / 3e-39 AT3G01190 412 / 4e-145 Peroxidase superfamily protein (.1)
Potri.001G011500 137 / 7e-39 AT5G06720 376 / 6e-131 peroxidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10007050 pacid=23153238 polypeptide=Lus10007050 locus=Lus10007050.g ID=Lus10007050.BGIv1.0 annot-version=v1.0
ATGACGAAAATAGTCGGGATGTCGACGTTGTTTGTGGTTTGGCTTGTGATGTTTCTAGCCAACAGGTCCGCTGTTGATGCCCAAGGGACTCGGGTAGGCT
TCTATTCCACTTCATGTCCACGAGCCGAGTCTATTGTTCGAGCAACGACAAGTGGCCCAAGCTGGACGGTGCCGACCGGGAGGAGAGACGGAAGGGTGTC
ATTGGCATCGGACACAACCAATTTGCCGGCGTTCAATGACTCGGCCGCAGTTCAAATTAGCAAGTACACTCAGAAAGGACTCAACACTCAGGATCTTGTT
GCTCTTTCTGGGGCCCACACAAACGCAAGCGCGCGGCCAGCCTGCGCGGTCTTCCGGTACAGGCTGTACAAGTGCCCGGGCTCTGCTTCCGGCGCCGACC
CAACGCTCGACCCGGCATTTGTTCCCCAACTGAGGGCGGTCTGCCCACAGAACGGAAATGCGGCAAGGAGGGTTGCTATGGACACTGGAAGCCCTAACCG
ATTCGACAATTCATACTACGCTAATCTCAGGAGCGGCCGAACTGTTCTTGAATCGGACTCTGTTCTGTGGACGGATGCCGGGACCAGAGTGATGGCACAG
AGGTTCCTCGGGATCAGAGGATTGGCCGGCTTGACTTTCGCAGTGGAGTTCGCCAGATCGATGGTGAGGATGGGCAACATCGAAATCAAGAGCGGCGCCC
AGGGTGAGATCCGGCGAGTCTGCTCCGCCGTCAACTGA
AA sequence
>Lus10007050 pacid=23153238 polypeptide=Lus10007050 locus=Lus10007050.g ID=Lus10007050.BGIv1.0 annot-version=v1.0
MTKIVGMSTLFVVWLVMFLANRSAVDAQGTRVGFYSTSCPRAESIVRATTSGPSWTVPTGRRDGRVSLASDTTNLPAFNDSAAVQISKYTQKGLNTQDLV
ALSGAHTNASARPACAVFRYRLYKCPGSASGADPTLDPAFVPQLRAVCPQNGNAARRVAMDTGSPNRFDNSYYANLRSGRTVLESDSVLWTDAGTRVMAQ
RFLGIRGLAGLTFAVEFARSMVRMGNIEIKSGAQGEIRRVCSAVN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64120 Peroxidase superfamily protein... Lus10007050 0 1
AT3G61850 DOF DAG1, AtDof3,7 dof affecting germination 1, D... Lus10012619 11.6 0.8805
AT2G41480 Peroxidase superfamily protein... Lus10007051 11.6 0.9238
AT2G16430 ATPAP10, PAP10 purple acid phosphatase 10 (.1... Lus10017485 11.7 0.9001
AT3G53990 Adenine nucleotide alpha hydro... Lus10017207 17.8 0.8971
AT3G14690 CYP72A15 "cytochrome P450, family 72, s... Lus10026178 18.1 0.9033
AT3G09270 ATGSTU8 glutathione S-transferase TAU ... Lus10001491 21.0 0.9062
AT5G38960 RmlC-like cupins superfamily p... Lus10006550 25.9 0.8502
AT3G04200 RmlC-like cupins superfamily p... Lus10006549 26.3 0.8439
AT1G47530 MATE efflux family protein (.1... Lus10042130 31.5 0.8923
AT4G35070 SBP (S-ribonuclease binding pr... Lus10019790 32.1 0.8926

Lus10007050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.