Lus10007060 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G29430 71 / 2e-16 SAUR-like auxin-responsive protein family (.1)
AT1G29510 70 / 7e-16 SAUR68 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
AT1G76190 69 / 7e-16 SAUR-like auxin-responsive protein family (.1)
AT1G29420 69 / 1e-15 SAUR-like auxin-responsive protein family (.1)
AT1G20470 69 / 2e-15 SAUR-like auxin-responsive protein family (.1)
AT1G29460 68 / 3e-15 SAUR-like auxin-responsive protein family (.1)
AT5G27780 66 / 2e-14 SAUR-like auxin-responsive protein family (.1)
AT1G29500 65 / 3e-14 SAUR-like auxin-responsive protein family (.1)
AT1G29440 64 / 1e-13 SAUR-like auxin-responsive protein family (.1)
AT1G29490 62 / 4e-13 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020432 183 / 8e-61 AT1G20470 69 / 3e-16 SAUR-like auxin-responsive protein family (.1)
Lus10007069 114 / 8e-34 AT1G29430 69 / 3e-16 SAUR-like auxin-responsive protein family (.1)
Lus10007067 113 / 3e-33 AT1G29430 69 / 4e-16 SAUR-like auxin-responsive protein family (.1)
Lus10020441 110 / 2e-32 AT1G29430 71 / 4e-17 SAUR-like auxin-responsive protein family (.1)
Lus10020440 110 / 3e-32 AT1G29430 72 / 3e-17 SAUR-like auxin-responsive protein family (.1)
Lus10007068 110 / 5e-32 AT1G29510 68 / 1e-15 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
Lus10020439 106 / 3e-30 AT1G29510 67 / 5e-15 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
Lus10007066 100 / 2e-28 AT1G29430 66 / 5e-15 SAUR-like auxin-responsive protein family (.1)
Lus10007057 87 / 1e-22 AT1G29450 72 / 2e-17 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G043400 78 / 3e-19 AT5G27780 141 / 8e-44 SAUR-like auxin-responsive protein family (.1)
Potri.004G181400 77 / 1e-18 AT1G29450 132 / 4e-40 SAUR-like auxin-responsive protein family (.1)
Potri.009G141201 77 / 2e-18 AT5G27780 132 / 3e-40 SAUR-like auxin-responsive protein family (.1)
Potri.002G064300 76 / 2e-18 AT1G29510 109 / 2e-31 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
Potri.009G141251 73 / 3e-17 AT1G29430 93 / 7e-25 SAUR-like auxin-responsive protein family (.1)
Potri.009G140900 72 / 6e-17 AT1G29510 139 / 3e-43 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
Potri.017G043500 72 / 8e-17 AT5G27780 120 / 1e-35 SAUR-like auxin-responsive protein family (.1)
Potri.009G141150 72 / 9e-17 AT1G29450 131 / 5e-40 SAUR-like auxin-responsive protein family (.1)
Potri.005G196850 73 / 2e-16 AT1G29510 102 / 2e-27 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
Potri.009G141100 69 / 1e-15 AT1G29510 117 / 8e-35 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10007060 pacid=23153270 polypeptide=Lus10007060 locus=Lus10007060.g ID=Lus10007060.BGIv1.0 annot-version=v1.0
ATGGTTCTTCTCGTAAAGCTAACTATGCAGAAATGGATGAAGCAGCTTAGTGTAACGAGGAGAATGCAAATGGCTTCGTCTTGTACGAGTGCGAAGGGTG
GTCATTTTGTGGTTTACACAGTGGATAGAAGGAGGTTTGTGATACCGTTGAAGTTTCTGAGAAGAATGGTGATTGTTGAATTACTGAAGATGGCAGAAGA
TGAATTTGGATTCTCAAGTGATGAACCAATTGTCTTGCCGTTTGAAGGTTATGTGATGGATGAAATCATTATGTTTCTATCCTCAGAATCAGATACCCAG
TCAGCACATTGTAGCATGCTCAGTACTCCACAGTTTCTAATTACCCCAGCATCCATCTGCATGCTGCCTAGAGCTTCTCTGTTTAATTGTTTCTTACCGT
CCAGTTTGGTAGAAACGTAG
AA sequence
>Lus10007060 pacid=23153270 polypeptide=Lus10007060 locus=Lus10007060.g ID=Lus10007060.BGIv1.0 annot-version=v1.0
MVLLVKLTMQKWMKQLSVTRRMQMASSCTSAKGGHFVVYTVDRRRFVIPLKFLRRMVIVELLKMAEDEFGFSSDEPIVLPFEGYVMDEIIMFLSSESDTQ
SAHCSMLSTPQFLITPASICMLPRASLFNCFLPSSLVET

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G29430 SAUR-like auxin-responsive pro... Lus10007060 0 1

Lus10007060 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.