Lus10007063 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20510 117 / 2e-31 OPCL1 OPC-8:0 CoA ligase1 (.1.2)
AT1G20480 100 / 6e-25 AMP-dependent synthetase and ligase family protein (.1)
AT5G38120 97 / 1e-23 4CL8 AMP-dependent synthetase and ligase family protein (.1)
AT1G20490 95 / 3e-23 AMP-dependent synthetase and ligase family protein (.1)
AT1G20500 90 / 4e-21 AMP-dependent synthetase and ligase family protein (.1)
AT4G05160 72 / 6e-15 AMP-dependent synthetase and ligase family protein (.1)
AT4G19010 68 / 1e-13 AMP-dependent synthetase and ligase family protein (.1)
AT5G63380 54 / 6e-09 AMP-dependent synthetase and ligase family protein (.1)
AT1G65060 50 / 2e-07 4CL3 4-coumarate:CoA ligase 3 (.1.2)
AT3G21230 48 / 9e-07 4CL5 4-coumarate:CoA ligase 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015998 176 / 1e-52 AT1G20510 833 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Lus10012280 162 / 1e-46 AT1G20510 825 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Lus10015999 102 / 2e-25 AT1G20510 692 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Lus10037934 84 / 5e-19 AT1G20510 462 / 2e-157 OPC-8:0 CoA ligase1 (.1.2)
Lus10038667 83 / 8e-19 AT1G20510 449 / 1e-152 OPC-8:0 CoA ligase1 (.1.2)
Lus10021431 74 / 1e-15 AT4G05160 803 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10016135 71 / 1e-14 AT4G05160 791 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10013831 71 / 1e-14 AT4G05160 654 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10026544 71 / 1e-14 AT4G05160 642 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G248500 124 / 1e-33 AT1G20510 795 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Potri.002G012800 124 / 2e-33 AT1G20510 769 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Potri.010G230200 80 / 8e-18 AT1G20510 478 / 7e-164 OPC-8:0 CoA ligase1 (.1.2)
Potri.008G031500 76 / 1e-16 AT1G20510 466 / 3e-159 OPC-8:0 CoA ligase1 (.1.2)
Potri.017G112800 70 / 2e-14 AT4G05160 852 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.004G102000 70 / 2e-14 AT4G05160 826 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.003G099700 67 / 2e-13 AT4G19010 634 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.006G169700 54 / 6e-09 AT3G21240 802 / 0.0 4-coumarate:CoA ligase 2 (.1)
Potri.017G033600 51 / 7e-08 AT5G63380 598 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.019G049500 51 / 9e-08 AT1G65060 781 / 0.0 4-coumarate:CoA ligase 3 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0378 ANL PF00501 AMP-binding AMP-binding enzyme
Representative CDS sequence
>Lus10007063 pacid=23153252 polypeptide=Lus10007063 locus=Lus10007063.g ID=Lus10007063.BGIv1.0 annot-version=v1.0
ATGGTGAAGTGGGTGGCTCATGAGGAGGTCAGTGTTAGTACAGACAGAGGTAGTAAAGAAAGAAAGAAGGAAGCTTTCAGCGGAGATTCCGCCAAAGTCC
CAGCTAACGTAACCCAATCCCTCGACGTCACAACCTTTCTCAAGCTCACCACGGCAAGACCGCCTTCATCGACGCCGCCACCTCACTTTCCGAGACCTAT
GGTCCCCCGTCGACTCCCTCGCCACGCATCTCACGAAACCATGGGATTCCGAAAGGGACACGTCGTCCTCCTCCTATCCCCTAATTCCATATCCTTCCCA
ATCGTTTGCCTCGCCGTCATGTCCATCGGCACAGTAATCACCACCACCAATCCTCTCAACACACCTGGCGAAATTGCCAAACGGATCTCCGATTCCAAGG
CTTCGTTGGCTTTCACCGTCCCCGAATTAGTCCCCAAACTCGCCGGTTCGAACCCTAACCTCCCGATCGTCCTAATCGATAGAGAGAATCAGGACTACAA
CTACAACGCAAGTAGACTCTAG
AA sequence
>Lus10007063 pacid=23153252 polypeptide=Lus10007063 locus=Lus10007063.g ID=Lus10007063.BGIv1.0 annot-version=v1.0
MVKWVAHEEVSVSTDRGSKERKKEAFSGDSAKVPANVTQSLDVTTFLKLTTARPPSSTPPPHFPRPMVPRRLPRHASHETMGFRKGHVVLLLSPNSISFP
IVCLAVMSIGTVITTTNPLNTPGEIAKRISDSKASLAFTVPELVPKLAGSNPNLPIVLIDRENQDYNYNASRL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G20510 OPCL1 OPC-8:0 CoA ligase1 (.1.2) Lus10007063 0 1
Lus10001257 14.5 0.6734
AT4G37260 MYB ATMYB73 myb domain protein 73 (.1) Lus10007503 51.4 0.6229
AT5G50600 ATHSD1 hydroxysteroid dehydrogenase 1... Lus10032556 61.5 0.6296
AT2G28390 SAND family protein (.1) Lus10021472 105.7 0.5803
AT2G30480 unknown protein Lus10019109 115.3 0.5824
AT5G62575 SDH7B, SDH7 succinate dehydrogenase 7B, su... Lus10004231 122.5 0.5532
AT5G56660 ILL2 IAA-leucine resistant (ILR)-li... Lus10029200 125.1 0.5355
AT5G02800 CDL1 CDG1-like 1, Protein kinase su... Lus10003995 149.0 0.5374
AT1G02790 PGA4 polygalacturonase 4 (.1) Lus10016823 219.9 0.4996
AT1G03430 AHP5 histidine-containing phosphotr... Lus10029623 220.2 0.5305

Lus10007063 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.