Lus10007072 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020445 135 / 3e-38 AT4G33620 404 / 6e-129 Cysteine proteinases superfamily protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10007072 pacid=23153272 polypeptide=Lus10007072 locus=Lus10007072.g ID=Lus10007072.BGIv1.0 annot-version=v1.0
ATGGAGATTGAAGTCTGTACGTTATCTGACCCAGGAACTAGTTCAAGGTCATTATACGACGAAATATTAATGTACCAGTGGAAACAAACGCATTATTCAA
TCACCTTGTCACCAGTCCAGGAAACGAAAGAGTGTGAATTGGCAACTGAAGACTGTTTCCGAGAAACACAAGACTGTGTGATGGCAACTGAAGACTGTTA
TCCAGAAACGCCAGAGTTTACGTTGGCAACTCACGACCGTTTGCTGGAAACTGGTGAATCTCCCACTGATCCCTTTTGTCGGAAAGTTTACATCGCCAGG
AGCACCTAG
AA sequence
>Lus10007072 pacid=23153272 polypeptide=Lus10007072 locus=Lus10007072.g ID=Lus10007072.BGIv1.0 annot-version=v1.0
MEIEVCTLSDPGTSSRSLYDEILMYQWKQTHYSITLSPVQETKECELATEDCFRETQDCVMATEDCYPETPEFTLATHDRLLETGESPTDPFCRKVYIAR
ST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10007072 0 1
AT1G50920 Nucleolar GTP-binding protein ... Lus10007958 9.2 0.6264
AT4G29100 bHLH bHLH068 basic helix-loop-helix (bHLH) ... Lus10011105 22.7 0.6412
AT2G38290 AMT2;1, ATAMT2 AMMONIUM TRANSPORTER 2;1, ammo... Lus10014713 42.3 0.5736
AT1G70710 CEL1 ,AtGH9B1 CELLULASE 1, glycosyl hydrolas... Lus10031139 46.9 0.5904
AT1G51990 O-methyltransferase family pro... Lus10033647 56.9 0.5938
AT3G51560 Disease resistance protein (TI... Lus10029858 67.8 0.5630
AT2G26850 F-box family protein (.1) Lus10036444 67.9 0.5648
AT2G45630 D-isomer specific 2-hydroxyaci... Lus10040679 71.4 0.5815
AT1G78930 Mitochondrial transcription te... Lus10035714 85.7 0.6010
Lus10024688 87.4 0.5557

Lus10007072 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.