Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020466 [exp] 65 / 9e-16 AT3G13275 64 / 1e-15 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007090 pacid=23153244 polypeptide=Lus10007090 locus=Lus10007090.g ID=Lus10007090.BGIv1.0 annot-version=v1.0 ATGTGCTGCGGGGGGAGAATGTGCATGATGTGCACGTGCGTGATTCTGGTGGTAGTGTTGATCGGATTGTTGTTCGGATTCGGAGTATTCAAGGATGGCT TCCACAAGTTGGAGGACACCGTTCACGATATCAATCACCTCCAGCAGCAGCAGGATCATGATTTCCACAGCCGTCCCTTCCTCAAAGGCGGCTTCCTTGC TCCGCCTCCTCTCTTCTGA
AA sequence Show only first row Show all	>Lus10007090 pacid=23153244 polypeptide=Lus10007090 locus=Lus10007090.g ID=Lus10007090.BGIv1.0 annot-version=v1.0 MCCGGRMCMMCTCVILVVVLIGLLFGFGVFKDGFHKLEDTVHDINHLQQQQDHDFHSRPFLKGGFLAPPPLF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G13275			unknown protein		Lus10007090 [exp]	0	1
AT5G05180			unknown protein		Lus10030507 [exp]	1.7	0.8809
AT5G05180			unknown protein		Lus10012861 [exp]	4.9	0.8461
AT3G45980		H2B, HTB9	HISTONE H2B, Histone superfami...		Lus10016156 [exp]	6.6	0.8655
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10014043 [exp]	9.2	0.8502
AT5G54630	C2H2ZnF		zinc finger protein-related (....		Lus10043080 [exp]	9.2	0.8556
AT1G04420			NAD(P)-linked oxidoreductase s...		Lus10003751 [exp]	12.4	0.8407
AT1G47720		OSB1	Organellar Single-stranded, Pr...		Lus10014728 [exp]	14.4	0.8200
AT3G63530		BB2, BB	BIG BROTHER, RING/U-box superf...		Lus10019703 [exp]	15.0	0.8327
AT4G37630		CYCD5;1	cyclin d5;1 (.1.2)		Lus10018688 [exp]	16.9	0.8278
AT5G49170			unknown protein		Lus10024954 [exp]	17.0	0.8470

Compare expression of checked genes

Lus10007090 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.