Lus10007092 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20650 162 / 5e-52 COPT5 copper transporter 5 (.1)
AT2G26975 67 / 1e-14 Ctr copper transporter family (.1)
AT5G59040 67 / 2e-14 COPT3 copper transporter 3 (.1)
AT3G46900 55 / 4e-10 COPT2 copper transporter 2 (.1)
AT5G59030 51 / 1e-08 COPT1 copper transporter 1 (.1)
AT2G37925 46 / 6e-07 COPT4 copper transporter 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012501 169 / 1e-54 AT5G20650 177 / 5e-58 copper transporter 5 (.1)
Lus10022671 166 / 1e-53 AT5G20650 176 / 2e-57 copper transporter 5 (.1)
Lus10040925 132 / 3e-40 AT5G20650 142 / 2e-44 copper transporter 5 (.1)
Lus10009819 130 / 3e-39 AT5G20650 147 / 5e-46 copper transporter 5 (.1)
Lus10040726 65 / 9e-14 AT2G26975 138 / 2e-42 Ctr copper transporter family (.1)
Lus10016464 56 / 2e-10 AT5G59030 151 / 1e-47 copper transporter 1 (.1)
Lus10023045 56 / 3e-10 AT2G26975 84 / 2e-21 Ctr copper transporter family (.1)
Lus10021107 53 / 2e-09 AT5G59040 87 / 1e-22 copper transporter 3 (.1)
Lus10017205 48 / 2e-07 AT2G26975 87 / 2e-22 Ctr copper transporter family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G140700 201 / 9e-68 AT5G20650 151 / 7e-48 copper transporter 5 (.1)
Potri.006G219200 162 / 3e-52 AT5G20650 140 / 1e-43 copper transporter 5 (.1)
Potri.009G038700 59 / 1e-11 AT2G26975 133 / 2e-40 Ctr copper transporter family (.1)
Potri.006G093200 54 / 6e-10 AT3G46900 89 / 6e-23 copper transporter 2 (.1)
Potri.001G246000 53 / 4e-09 AT5G59030 134 / 9e-41 copper transporter 1 (.1)
Potri.009G038800 52 / 7e-09 AT5G59030 148 / 4e-46 copper transporter 1 (.1)
Potri.006G093300 52 / 7e-09 AT2G37925 114 / 3e-33 copper transporter 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04145 Ctr Ctr copper transporter family
Representative CDS sequence
>Lus10007092 pacid=23153267 polypeptide=Lus10007092 locus=Lus10007092.g ID=Lus10007092.BGIv1.0 annot-version=v1.0
ATGATGCACATGACCATGTACTGGGGAATCAGTGTCACTCTCCTCTTCGACTCCTGGAAAACCGACTCCCTCTTCTCTTACCTCCTCACTTTACTCGCCT
GCTTCCTCTTCTCCGCCTTCTATCAATACATGGAAGATCGCCGCCTCCGATTCAAGGCCGCCGCTCTTGCCGCTTCCTCCTTCTCCTCCTCGCCTCCTTC
TTTAGTCAACGCCCCCCTCCTCCTCCGCAAGCTAAGTGGCAACCCCATTCAGCCAGCCAAGCTAGCTGGAGCCCTCCTCTTCGGGATCAACTCCGCGATC
GGCTATTTTCTCATGTTGGCCATCATGTCCTTCAACGGCGGCGTTTTCCTGGCTATCGTTCTGGGCTTGTCCATCGGCTATTTACTCTTCAGGAGCGGAG
ACGACGAGGCGGTCGTCGTGGATAATCCCTGCGCTTGTGCCTGA
AA sequence
>Lus10007092 pacid=23153267 polypeptide=Lus10007092 locus=Lus10007092.g ID=Lus10007092.BGIv1.0 annot-version=v1.0
MMHMTMYWGISVTLLFDSWKTDSLFSYLLTLLACFLFSAFYQYMEDRRLRFKAAALAASSFSSSPPSLVNAPLLLRKLSGNPIQPAKLAGALLFGINSAI
GYFLMLAIMSFNGGVFLAIVLGLSIGYLLFRSGDDEAVVVDNPCACA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G20650 COPT5 copper transporter 5 (.1) Lus10007092 0 1
AT1G12310 Calcium-binding EF-hand family... Lus10028915 7.9 0.8226
AT5G16540 C3HZnF ZFN3 zinc finger nuclease 3 (.1.2.3... Lus10031527 8.5 0.7420
AT3G18490 Eukaryotic aspartyl protease f... Lus10032482 9.9 0.8226
AT3G24040 Core-2/I-branching beta-1,6-N-... Lus10011765 10.8 0.7885
AT3G05545 RING/U-box superfamily protein... Lus10029886 14.1 0.7800
AT5G40190 RNA ligase/cyclic nucleotide p... Lus10039477 14.5 0.8073
AT3G05500 Rubber elongation factor prote... Lus10029892 16.0 0.7490
AT1G65270 unknown protein Lus10020224 17.3 0.7762
AT2G19270 unknown protein Lus10015539 17.9 0.7877
AT3G15810 Protein of unknown function (D... Lus10007118 18.5 0.7474

Lus10007092 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.