Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007097 pacid=23153222 polypeptide=Lus10007097 locus=Lus10007097.g ID=Lus10007097.BGIv1.0 annot-version=v1.0 ATGGGGATATTGAGGGGATGGATGTCTCCATACATTGCTTTCACTGCTTCCCTGTACGGACCTCTATTGAGCAGCCTCAAGAGAACCTTGAAGGCAGCTA GATATCGGGAAGCAGATAGTGAAGATGATGACGATGACAATATTAGTGAAGAACAGACGAATTACTCGAGTAGAAGCACTTGA
AA sequence Show only first row Show all	>Lus10007097 pacid=23153222 polypeptide=Lus10007097 locus=Lus10007097.g ID=Lus10007097.BGIv1.0 annot-version=v1.0 MGILRGWMSPYIAFTASLYGPLLSSLKRTLKAARYREADSEDDDDDNISEEQTNYSSRST

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10007097 [exp]	0	1
AT3G29810		COBL2	COBRA-like protein 2 precursor...		Lus10042386 [exp]	3.2	0.9362
AT1G70580		GGT2, AOAT2	GLUTAMATE:GLYOXYLATE AMINOTRAN...		Lus10006203 [exp]	5.2	0.9371
AT5G51780	bHLH	bHLH036	basic helix-loop-helix (bHLH) ...		Lus10027395 [exp]	5.7	0.9344
					Lus10020564 [exp]	12.4	0.9308
AT4G09960	MADS	AGL11, STK	SEEDSTICK, AGAMOUS-like 11, K-...		Lus10009481 [exp]	13.8	0.9109
AT1G64960		HEB1	hypersensitive to excess boron...		Lus10025197 [exp]	20.6	0.9129
AT2G38750		ANNAT4	annexin 4 (.1)		Lus10024171 [exp]	25.7	0.9048
					Lus10020448 [exp]	28.3	0.8721
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10031145 [exp]	29.4	0.9316
AT4G38580		HIPP26, ATFP6	HEAVY METAL ASSOCIATED ISOPREN...		Lus10014120 [exp]	30.0	0.8956

Compare expression of checked genes

Lus10007097 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.