Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57230 226 / 5e-75 MADS AGL16 AGAMOUS-like 16 (.1.2) AT4G37940 224 / 2e-74 MADS AGL21 AGAMOUS-like 21 (.1) AT2G22630 214 / 2e-70 MADS AGL17 AGAMOUS-like 17 (.1) AT2G14210 199 / 3e-64 MADS AGL44, ANR1 ARABIDOPSIS NITRATE REGULATED 1, AGAMOUS-like 44 (.1) AT1G26310 152 / 7e-46 MADS CAL1, AGL10, CAL CAULIFLOWER, AGAMOUS-like 10, K-box region and MADS-box transcription factor family protein (.1) AT1G69120 145 / 5e-43 MADS AGL7, AP1 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) AT4G09960 144 / 1e-42 MADS AGL11, STK SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) AT2G42830 144 / 1e-42 MADS AGL5, SHP2 SHATTERPROOF 2, AGAMOUS-like 5, K-box region and MADS-box transcription factor family protein (.1.2) AT2G45650 144 / 2e-42 MADS AGL6 AGAMOUS-like 6 (.1) AT5G60910 143 / 2e-42 MADS FUL, AGL8 FRUITFULL, AGAMOUS-like 8 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020477 [exp] 261 / 7e-90 AT4G37940 195 / 4e-64 AGAMOUS-like 21 (.1) Lus10017871 [exp] 144 / 2e-43 AT1G69120 264 / 2e-90 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Lus10021140 [exp] 144 / 1e-42 AT5G60910 291 / 1e-99 FRUITFULL, AGAMOUS-like 8 (.1.2) Lus10007983 [exp] 144 / 2e-42 AT5G60910 298 / 3e-102 FRUITFULL, AGAMOUS-like 8 (.1.2) Lus10004638 [exp] 142 / 4e-42 AT3G02310 246 / 2e-82 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Lus10034662 [exp] 142 / 4e-42 AT5G60910 284 / 3e-97 FRUITFULL, AGAMOUS-like 8 (.1.2) Lus10004637 [exp] 140 / 2e-41 AT1G69120 318 / 2e-111 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Lus10026679 [exp] 140 / 2e-41 AT1G69120 338 / 1e-118 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Lus10009481 [exp] 141 / 4e-41 AT4G09960 274 / 1e-92 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G079000 [exp] 260 / 2e-88 AT4G37940 293 / 3e-101 AGAMOUS-like 21 (.1) Potri.001G284600 [exp] 255 / 2e-86 AT4G37940 272 / 7e-93 AGAMOUS-like 21 (.1) Potri.001G284301 [exp] 255 / 2e-86 AT4G37940 272 / 7e-93 AGAMOUS-like 21 (.1) Potri.005G150501 [exp] 241 / 2e-80 AT3G57230 322 / 8e-112 AGAMOUS-like 16 (.1.2) Potri.002G109601 [exp] 236 / 6e-79 AT3G57230 299 / 1e-103 AGAMOUS-like 16 (.1.2) Potri.013G104900 [exp] 145 / 1e-43 AT4G09960 330 / 3e-116 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Potri.011G075800 [exp] 142 / 7e-42 AT4G18960 325 / 2e-113 AGAMOUS, K-box region and MADS-box transcription factor family protein (.1.2) Potri.014G074100 [exp] 140 / 2e-41 AT2G45650 311 / 5e-108 AGAMOUS-like 6 (.1) Potri.012G062300 [exp] 140 / 2e-41 AT5G60910 288 / 5e-99 FRUITFULL, AGAMOUS-like 8 (.1.2) Potri.004G064300 [exp] 140 / 3e-41 AT4G18960 313 / 8e-109 AGAMOUS, K-box region and MADS-box transcription factor family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01486 [flax] [poplar] K-box K-box region PF00319 [flax] [poplar] SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain)
Representative CDS sequence Show only first row Show all	>Lus10007100 pacid=23153246 polypeptide=Lus10007100 locus=Lus10007100.g ID=Lus10007100.BGIv1.0 annot-version=v1.0 ATGGGAAGGGGGAAGACAGTGATAAGGAGGATCGATGACAGAACGAACAGGCAGGTGACTTTCTCAAAGAGAAGAACCGGTTTGATTAAGAAAGCAAAGG AGCTATCCATCCTTTGTGATGCTCAAATTGCTCTCATTGTTTTCTCCACTACCAACAAGCTCTATCAATTTTCCAGTACCAGTATGATGTCGATCATTGA TCGTTACACCAGACAGAAAGAAGCTCACAGTCAGCCAGTCAATCCTGCATCAGAGATCAAGTTTTGGCAGAAGGAGGCAGCAAAACTCAAGAGGGAACTG CAGTCCTTAAATGAATATCACAGACAATTAATGGGAGAAGAAGTATCAGGCTTGAGTGTCAGAGATCTGCAAAATTTGGAAACCCAGCTTGAGATTAGTT TGAAAGCAATCCGCCTCAAGAAGCACAATACGATGACAGATCAAATAACAGCCTTGACCGCAAAGGGAAATCAATGTTACGAAGAAAATATACAACTTCA CAAGCAGTTCAATTTCTTCGCCAATGAAAAATCAGCACTCGGTATAAAGGTATATGAAGAAAGGAATGCAGAAGAAACCGATGGAATGGCGAAGGCTGCG GTCAGTCTGCAATTGACCCAACCTGAACCCCTGAAATTAGGGTAG
AA sequence Show only first row Show all	>Lus10007100 pacid=23153246 polypeptide=Lus10007100 locus=Lus10007100.g ID=Lus10007100.BGIv1.0 annot-version=v1.0 MGRGKTVIRRIDDRTNRQVTFSKRRTGLIKKAKELSILCDAQIALIVFSTTNKLYQFSSTSMMSIIDRYTRQKEAHSQPVNPASEIKFWQKEAAKLKREL QSLNEYHRQLMGEEVSGLSVRDLQNLETQLEISLKAIRLKKHNTMTDQITALTAKGNQCYEENIQLHKQFNFFANEKSALGIKVYEERNAEETDGMAKAA VSLQLTQPEPLKLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G57230	MADS	AGL16	AGAMOUS-like 16 (.1.2)		Lus10007100 [exp]	0	1
AT2G01980		ATSOS1, SOS1, A...	ARABIDOPSIS SALT OVERLY SENSIT...		Lus10039133 [exp]	18.5	0.8431
AT3G11480		BSMT1, ATBSMT1	S-adenosyl-L-methionine-depend...		Lus10036550 [exp]	26.2	0.8430
AT4G02340			alpha/beta-Hydrolases superfam...		Lus10006827 [exp]	27.8	0.8329
AT5G66040		STR16	sulfurtransferase protein 16 (...		Lus10021227 [exp]	29.7	0.8358
AT5G52450			MATE efflux family protein (.1...		Lus10019492 [exp]	36.4	0.7633
AT3G01420		PADOX-1, ALPHA-...	plant alpha dioxygenase 1, alp...		Lus10039436 [exp]	81.2	0.7731
AT1G44970			Peroxidase superfamily protein...		Lus10010634 [exp]	86.1	0.8044
AT5G06300		LOG7	LONELY GUY 7, Putative lysine ...		Lus10029425 [exp]	87.9	0.7824
AT2G46270	bZIP	GBF3	G-box binding factor 3 (.1.2)		Lus10005146 [exp]	91.4	0.7713
AT4G12240	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10024570 [exp]	93.2	0.8025

Compare expression of checked genes

Lus10007100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.