Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65032 95 / 3e-27 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020483 [exp] 150 / 4e-49 AT1G65032 117 / 3e-36 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G094100 [exp] 122 / 6e-38 AT1G65032 107 / 6e-32 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007103 pacid=23153245 polypeptide=Lus10007103 locus=Lus10007103.g ID=Lus10007103.BGIv1.0 annot-version=v1.0 ATGGCGAAAGGCCTGGTGTGGGCGACAGCTGAAGATTTGGCACGGAATAGAGGGTGTGTTCTGTCTCTGTACCGCCAACTATTACGCAGTCTCAACTCTC CAAGTTTACCTCTTAATTTAGCAGCAAGATTGGCTAAGAAGGCTGAAGTTCGTGCCATCTTCTTGCTGGGATCCGAGGAAAAGTCTGTCCACAATATCAA GGATCTCACTGACACTGCTGAATACGCTTTGGGTCTCCTCAGAAAGGGCGAGATTCCCAAGTATATACAATGA
AA sequence Show only first row Show all	>Lus10007103 pacid=23153245 polypeptide=Lus10007103 locus=Lus10007103.g ID=Lus10007103.BGIv1.0 annot-version=v1.0 MAKGLVWATAEDLARNRGCVLSLYRQLLRSLNSPSLPLNLAARLAKKAEVRAIFLLGSEEKSVHNIKDLTDTAEYALGLLRKGEIPKYIQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G65032			unknown protein		Lus10007103 [exp]	0	1
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10033806 [exp]	4.8	0.7629
AT4G05530		SDRA, IBR1	SHORT-CHAIN DEHYDROGENASE/REDU...		Lus10015542 [exp]	13.1	0.7550
AT3G58030			RING/U-box superfamily protein...		Lus10004162 [exp]	17.9	0.7296
AT4G33740			unknown protein		Lus10012453 [exp]	18.2	0.7312
AT2G35900			unknown protein		Lus10021249 [exp]	18.7	0.7382
					Lus10039242 [exp]	19.0	0.6800
AT4G18372			Small nuclear ribonucleoprotei...		Lus10042823 [exp]	22.8	0.7282
AT1G65032			unknown protein		Lus10020483 [exp]	24.5	0.7073
AT2G36930	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10023928 [exp]	25.9	0.7284
AT5G41685			Mitochondrial outer membrane t...		Lus10001641 [exp]	26.8	0.6925

Compare expression of checked genes

Lus10007103 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.