Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14610 99 / 2e-27 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT4G33720 96 / 2e-26 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14580 93 / 5e-25 ATPRB1 basic pathogenesis-related protein 1 (.1) AT4G33730 84 / 3e-21 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 76 / 2e-18 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G26130 76 / 3e-18 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G19990 74 / 2e-17 PR-1-LIKE pathogenesis-related protein-1-like (.1) AT4G31470 69 / 2e-15 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G07820 68 / 3e-15 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G19970 67 / 1e-14 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020493 [exp] 101 / 3e-28 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1) Lus10012479 [exp] 101 / 4e-28 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1) Lus10020492 [exp] 95 / 6e-26 AT2G14610 157 / 4e-50 pathogenesis-related gene 1 (.1) Lus10020491 [exp] 92 / 2e-24 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1) Lus10007102 [exp] 88 / 9e-23 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10012478 [exp] 88 / 1e-22 AT2G14610 170 / 1e-54 pathogenesis-related gene 1 (.1) Lus10020481 [exp] 87 / 3e-22 AT2G14610 176 / 6e-57 pathogenesis-related gene 1 (.1) Lus10020482 [exp] 79 / 1e-19 AT2G14610 129 / 8e-39 pathogenesis-related gene 1 (.1) Lus10020480 [exp] 77 / 2e-18 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G083300 [exp] 106 / 3e-30 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083100 [exp] 105 / 5e-30 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 103 / 3e-29 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288600 [exp] 100 / 1e-27 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1) Potri.001G288401 [exp] 100 / 1e-27 AT2G14610 178 / 4e-58 pathogenesis-related gene 1 (.1) Potri.009G082900 [exp] 98 / 1e-26 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.001G288301 [exp] 97 / 1e-26 AT2G14580 202 / 1e-67 basic pathogenesis-related protein 1 (.1) Potri.009G082800 [exp] 87 / 1e-22 AT2G14610 171 / 4e-55 pathogenesis-related gene 1 (.1) Potri.009G083600 [exp] 77 / 9e-19 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096007 [exp] 65 / 5e-14 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10007110 pacid=23153235 polypeptide=Lus10007110 locus=Lus10007110.g ID=Lus10007110.BGIv1.0 annot-version=v1.0 ATGTATAAAAATGAAAACACAATTCCCCTCCTCCTCCTCCTCTTAATTCTCTCGGTCTTCATCCCAACACTCGGCCACGACGCCCCCGAGGACTTCCTCG CAGCCCACAACAAAGTGCGGGCCGAAAATAGGGTGGGGCCCTTGGTATGGAGCCCCATTCTAGCGGCGTACGCCAACAGATACGCCACGAAGCTGGCCGA GGGTGGATGCCAGCTGGAGCATTCGGACGGCCCCTACGGAGAGAACCTTGCGTGGTGCAGCGAAGATCTGTTCGGGACGAGGGCGGTGGAGCTGTGGGCG GAGGAGAAGGCCGATTACGACTACAACGCTTTCATCTATCTTAGATTGTTAATCAAATGA
AA sequence Show only first row Show all	>Lus10007110 pacid=23153235 polypeptide=Lus10007110 locus=Lus10007110.g ID=Lus10007110.BGIv1.0 annot-version=v1.0 MYKNENTIPLLLLLLILSVFIPTLGHDAPEDFLAAHNKVRAENRVGPLVWSPILAAYANRYATKLAEGGCQLEHSDGPYGENLAWCSEDLFGTRAVELWA EEKADYDYNAFIYLRLLIK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10007110 [exp]	0	1
AT3G54200			Late embryogenesis abundant (L...		Lus10006764 [exp]	6.3	0.7102
AT3G14040			Pectin lyase-like superfamily ...		Lus10041051 [exp]	8.2	0.5727
AT3G61220		SDR1	short-chain dehydrogenase/redu...		Lus10006893 [exp]	8.9	0.7102
AT5G27260			unknown protein		Lus10007175 [exp]	11.0	0.7102
AT1G63640			P-loop nucleoside triphosphate...		Lus10009028 [exp]	12.6	0.7102
					Lus10009317 [exp]	14.1	0.7102
AT1G61320			FBD / Leucine Rich Repeat doma...		Lus10010664 [exp]	15.5	0.7102
AT5G05070			DHHC-type zinc finger family p...		Lus10027274 [exp]	16.7	0.7102
AT1G28300	B3	LEC2	LEAFY COTYLEDON 2, AP2/B3-like...		Lus10014005 [exp]	17.9	0.7102
AT3G02960			Heavy metal transport/detoxifi...		Lus10015762 [exp]	19.0	0.7102

Compare expression of checked genes

Lus10007110 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.