Lus10007113 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55590 209 / 4e-67 QRT1 QUARTET 1, Pectin lyase-like superfamily protein (.1)
AT5G47500 163 / 3e-49 PME5 pectin methylesterase 5, Pectin lyase-like superfamily protein (.1)
AT5G19730 135 / 2e-38 Pectin lyase-like superfamily protein (.1)
AT1G05310 117 / 3e-31 Pectin lyase-like superfamily protein (.1)
AT2G21610 110 / 5e-29 PE11, ATPE11 A. THALIANA PECTINESTERASE 11, pectinesterase 11 (.1)
AT2G36710 110 / 1e-28 Pectin lyase-like superfamily protein (.1)
AT2G36700 107 / 4e-28 Pectin lyase-like superfamily protein (.1)
AT5G61680 102 / 2e-26 Pectin lyase-like superfamily protein (.1)
AT5G07410 102 / 3e-26 Pectin lyase-like superfamily protein (.1)
AT5G07430 101 / 8e-26 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016605 302 / 3e-103 AT5G55590 409 / 3e-142 QUARTET 1, Pectin lyase-like superfamily protein (.1)
Lus10004720 155 / 3e-46 AT5G47500 519 / 0.0 pectin methylesterase 5, Pectin lyase-like superfamily protein (.1)
Lus10028364 136 / 4e-39 AT5G19730 437 / 4e-154 Pectin lyase-like superfamily protein (.1)
Lus10041815 137 / 7e-39 AT5G19730 446 / 1e-156 Pectin lyase-like superfamily protein (.1)
Lus10042315 134 / 5e-38 AT2G21610 383 / 5e-133 A. THALIANA PECTINESTERASE 11, pectinesterase 11 (.1)
Lus10026347 125 / 6e-35 AT2G21610 399 / 2e-139 A. THALIANA PECTINESTERASE 11, pectinesterase 11 (.1)
Lus10012942 125 / 3e-34 AT5G19730 594 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10023560 122 / 2e-33 AT2G21610 368 / 4e-127 A. THALIANA PECTINESTERASE 11, pectinesterase 11 (.1)
Lus10009997 120 / 7e-33 AT5G19730 320 / 1e-107 Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G365700 236 / 6e-77 AT5G55590 429 / 1e-149 QUARTET 1, Pectin lyase-like superfamily protein (.1)
Potri.003G076900 154 / 9e-46 AT5G47500 554 / 0.0 pectin methylesterase 5, Pectin lyase-like superfamily protein (.1)
Potri.007G015700 135 / 1e-38 AT5G19730 472 / 2e-167 Pectin lyase-like superfamily protein (.1)
Potri.018G068400 128 / 1e-35 AT5G19730 603 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.004G156300 121 / 3e-33 AT2G21610 457 / 3e-162 A. THALIANA PECTINESTERASE 11, pectinesterase 11 (.1)
Potri.006G120100 120 / 2e-32 AT2G36710 449 / 3e-157 Pectin lyase-like superfamily protein (.1)
Potri.014G117100 114 / 3e-30 AT5G19730 320 / 3e-107 Pectin lyase-like superfamily protein (.1)
Potri.016G017700 110 / 8e-29 AT1G05310 511 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.006G137100 106 / 2e-27 AT1G69940 355 / 1e-121 Pectin lyase-like superfamily protein (.1)
Potri.012G113533 100 / 2e-25 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF01095 Pectinesterase Pectinesterase
Representative CDS sequence
>Lus10007113 pacid=23139747 polypeptide=Lus10007113 locus=Lus10007113.g ID=Lus10007113.BGIv1.0 annot-version=v1.0
ATGTGCAGGGAGAAGGTAGTTGTGCCGGTTACAAAGGCGTACATATCGTTGATTGGGAATGAAAGCGACGTATCAACGACAGTGATAACCTGGCACAACA
AAACTTTTAATTTGGATTCTAATGGGAATGAGCTTGGTACTTTTAAGTCAGCATCAGTCACCGTTTCCTCTGATTATTTCTGCGCTACAGGGATCACTTT
CCAGGGTATTTATTATTGGGCAGAATTCGGTGGTGGCCGTAGCAGGAGGGCATGGGATGCAAGCAGTGCGCTGAGAGTGTCAGGGGACAAAGCATTCTTC
TACAGAGTTAAGATTGCTGGCTCACAGGACACCCTTTTGGACGACACTGGTTCACATTACTATTACCAATCTCACATTCTTGGAAGCAGTGATTTTTTAT
TTGGTCGTGGAAGGTCTCTCTTTCAGGATTGCATAGTGGAATCGAAAGCTGAGAGGTGCGGAGCGATTGCAGATCACCACAGAGATTCAGGAAACGATGA
GACTGGCTTCTCCTTCGTAGGGTGCTTAATCAGAGGAACTGGCAAGATTCTATTGGGAAGAGCTTGA
AA sequence
>Lus10007113 pacid=23139747 polypeptide=Lus10007113 locus=Lus10007113.g ID=Lus10007113.BGIv1.0 annot-version=v1.0
MCREKVVVPVTKAYISLIGNESDVSTTVITWHNKTFNLDSNGNELGTFKSASVTVSSDYFCATGITFQGIYYWAEFGGGRSRRAWDASSALRVSGDKAFF
YRVKIAGSQDTLLDDTGSHYYYQSHILGSSDFLFGRGRSLFQDCIVESKAERCGAIADHHRDSGNDETGFSFVGCLIRGTGKILLGRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G55590 QRT1 QUARTET 1, Pectin lyase-like s... Lus10007113 0 1
AT5G52975 Protein of unknown function (D... Lus10027141 1.0 0.8752
AT1G17810 BETA-TIP beta-tonoplast intrinsic prote... Lus10018256 2.0 0.8003
AT4G36945 PLC-like phosphodiesterases su... Lus10019339 12.2 0.7715
AT5G53480 ARM repeat superfamily protein... Lus10014540 12.6 0.6700
AT5G40780 LHT1, LTH1 lysine histidine transporter 1... Lus10014606 17.1 0.7568
AT5G19630 alpha/beta-Hydrolases superfam... Lus10021039 18.0 0.7335
AT5G40780 LHT1, LTH1 lysine histidine transporter 1... Lus10032073 18.8 0.7335
AT1G77460 Armadillo/beta-catenin-like re... Lus10029690 20.0 0.7291
AT4G34260 AXY8, FUC95A ALTERED XYLOGLUCAN 8, 1,2-alph... Lus10013884 21.4 0.7287
Lus10008773 22.3 0.5802

Lus10007113 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.