Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G19730 62 / 5e-13 Pectin lyase-like superfamily protein (.1) AT5G55590 60 / 3e-12 QRT1 QUARTET 1, Pectin lyase-like superfamily protein (.1) AT2G36710 58 / 2e-11 Pectin lyase-like superfamily protein (.1) AT2G21610 49 / 2e-08 PE11, ATPE11 A. THALIANA PECTINESTERASE 11, pectinesterase 11 (.1) AT1G05310 47 / 7e-08 Pectin lyase-like superfamily protein (.1) AT3G17060 47 / 1e-07 Pectin lyase-like superfamily protein (.1) AT2G36700 45 / 4e-07 Pectin lyase-like superfamily protein (.1) AT4G00190 43 / 2e-06 PME38, ATPME38 A. THALIANA PECTIN METHYLESTERASE 38, pectin methylesterase 38 (.1) AT5G47500 41 / 1e-05 PME5 pectin methylesterase 5, Pectin lyase-like superfamily protein (.1) AT1G69940 40 / 2e-05 ATPPME1 Pectin lyase-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016605 [exp] 134 / 1e-39 AT5G55590 409 / 3e-142 QUARTET 1, Pectin lyase-like superfamily protein (.1) Lus10009997 [exp] 61 / 1e-12 AT5G19730 320 / 1e-107 Pectin lyase-like superfamily protein (.1) Lus10027737 [exp] 59 / 1e-11 AT2G36710 427 / 2e-148 Pectin lyase-like superfamily protein (.1) Lus10012942 [exp] 58 / 2e-11 AT5G19730 594 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10043035 [exp] 57 / 3e-11 AT5G19730 555 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10041815 [exp] 57 / 3e-11 AT5G19730 446 / 1e-156 Pectin lyase-like superfamily protein (.1) Lus10028364 [exp] 56 / 9e-11 AT5G19730 437 / 4e-154 Pectin lyase-like superfamily protein (.1) Lus10011132 [exp] 56 / 1e-10 AT5G19730 575 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10010470 [exp] 54 / 5e-10 AT1G05310 521 / 0.0 Pectin lyase-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G365700 [exp] 69 / 2e-15 AT5G55590 429 / 1e-149 QUARTET 1, Pectin lyase-like superfamily protein (.1) Potri.007G015700 [exp] 65 / 4e-14 AT5G19730 472 / 2e-167 Pectin lyase-like superfamily protein (.1) Potri.015G110700 [exp] 64 / 1e-13 AT1G69940 393 / 2e-136 Pectin lyase-like superfamily protein (.1) Potri.012G113533 [exp] 64 / 1e-13 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1) Potri.012G113433 [exp] 64 / 1e-13 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1) Potri.012G112800 [exp] 64 / 1e-13 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1) Potri.012G114266 [exp] 64 / 1e-13 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1) Potri.012G114900 [exp] 64 / 1e-13 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1) Potri.006G186100 [exp] 63 / 2e-13 AT1G69940 412 / 4e-144 Pectin lyase-like superfamily protein (.1) Potri.006G186000 [exp] 63 / 2e-13 AT1G69940 412 / 4e-144 Pectin lyase-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [flax] [poplar] Pec_lyase-like PF01095 [flax] [poplar] Pectinesterase Pectinesterase
Representative CDS sequence Show only first row Show all	>Lus10007114 pacid=23139752 polypeptide=Lus10007114 locus=Lus10007114.g ID=Lus10007114.BGIv1.0 annot-version=v1.0 ATGATCACTCCCGAAGGATGGAGTGATTGGGATGTACCAGACAGACGAAATATCGCGGCCTGTTGCAGAACTGCAGTATTTGGAGAGTACAGATGCAAGG GAAGAGGAGCAGATACAAGGGGAAGAGTAGCTGGGCCCAAGACCAACTTCACACTTGAGCAAGTTAGACCATTCTTGGACCTCAGATTCATAGAAGGGCA CCAGTGGCTCAGACTCTAG
AA sequence Show only first row Show all	>Lus10007114 pacid=23139752 polypeptide=Lus10007114 locus=Lus10007114.g ID=Lus10007114.BGIv1.0 annot-version=v1.0 MITPEGWSDWDVPDRRNIAACCRTAVFGEYRCKGRGADTRGRVAGPKTNFTLEQVRPFLDLRFIEGHQWLRL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G19730			Pectin lyase-like superfamily ...		Lus10007114 [exp]	0	1
AT5G22450			unknown protein		Lus10000530 [exp]	7.9	1.0000
					Lus10003082 [exp]	10.1	1.0000
AT1G14000		VIK	VH1-interacting kinase (.1)		Lus10004066 [exp]	12.6	1.0000
					Lus10003536 [exp]	13.3	1.0000
AT2G23540			GDSL-like Lipase/Acylhydrolase...		Lus10005236 [exp]	14.7	1.0000
AT4G27790			Calcium-binding EF hand family...		Lus10005911 [exp]	15.0	1.0000
AT4G17220		ATMAP70-5	microtubule-associated protein...		Lus10003908 [exp]	15.9	1.0000
AT4G19540		INDH, INDL	IND1(iron-sulfur protein requi...		Lus10011951 [exp]	19.0	1.0000
AT3G49720			unknown protein		Lus10012481 [exp]	21.6	1.0000
					Lus10011078 [exp]	22.3	1.0000

Compare expression of checked genes

Lus10007114 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.