Lus10007119 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07130 362 / 2e-122 ATPAP15, PAP15 purple acid phosphatase 15 (.1)
AT4G13700 302 / 6e-100 ATPAP23, PAP23 purple acid phosphatase 23 (.1)
AT2G32770 292 / 9e-95 PAP13, ATPAP13 purple acid phosphatase 13 (.1.2.3)
AT3G52810 131 / 1e-34 ATPAP21, PAP21 purple acid phosphatase 21 (.1)
AT3G52820 130 / 2e-34 ATPAP22, PAP22 purple acid phosphatase 22 (.1)
AT3G52780 118 / 3e-30 ATPAP20, PAP20 Purple acid phosphatases superfamily protein (.1.2)
AT3G20500 109 / 9e-27 ATPAP18, PAP18 purple acid phosphatase 18 (.1)
AT1G56360 99 / 5e-23 PAP6, ATPAP6 purple acid phosphatase 6 (.1)
AT5G34850 99 / 1e-22 ATPAP26, PAP26 purple acid phosphatase 26 (.1)
AT2G16430 97 / 3e-22 ATPAP10, PAP10 purple acid phosphatase 10 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016665 579 / 0 AT3G07130 672 / 0.0 purple acid phosphatase 15 (.1)
Lus10011847 367 / 4e-124 AT3G07130 830 / 0.0 purple acid phosphatase 15 (.1)
Lus10022786 363 / 2e-122 AT3G07130 828 / 0.0 purple acid phosphatase 15 (.1)
Lus10016667 348 / 1e-115 AT3G07130 788 / 0.0 purple acid phosphatase 15 (.1)
Lus10028533 308 / 1e-100 AT4G13700 696 / 0.0 purple acid phosphatase 23 (.1)
Lus10007117 186 / 7e-57 AT3G07130 221 / 2e-27 purple acid phosphatase 15 (.1)
Lus10009113 153 / 6e-45 AT4G13700 259 / 3e-85 purple acid phosphatase 23 (.1)
Lus10021376 127 / 1e-33 AT3G52780 539 / 0.0 Purple acid phosphatases superfamily protein (.1.2)
Lus10021378 124 / 5e-31 AT3G52820 597 / 0.0 purple acid phosphatase 22 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G055800 405 / 4e-139 AT3G07130 677 / 0.0 purple acid phosphatase 15 (.1)
Potri.017G055900 371 / 9e-126 AT3G07130 816 / 0.0 purple acid phosphatase 15 (.1)
Potri.002G243900 370 / 2e-125 AT3G07130 805 / 0.0 purple acid phosphatase 15 (.1)
Potri.003G176000 301 / 8e-98 AT4G13700 739 / 0.0 purple acid phosphatase 23 (.1)
Potri.018G123700 117 / 3e-29 AT5G34850 762 / 0.0 purple acid phosphatase 26 (.1)
Potri.006G063700 115 / 1e-28 AT5G34850 798 / 0.0 purple acid phosphatase 26 (.1)
Potri.018G024800 112 / 1e-27 AT5G34850 742 / 0.0 purple acid phosphatase 26 (.1)
Potri.011G138200 112 / 1e-27 AT3G20500 696 / 0.0 purple acid phosphatase 18 (.1)
Potri.001G423700 111 / 3e-27 AT3G20500 701 / 0.0 purple acid phosphatase 18 (.1)
Potri.005G233400 108 / 5e-26 AT2G16430 700 / 0.0 purple acid phosphatase 10 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0163 Calcineurin PF00149 Metallophos Calcineurin-like phosphoesterase
Representative CDS sequence
>Lus10007119 pacid=23139745 polypeptide=Lus10007119 locus=Lus10007119.g ID=Lus10007119.BGIv1.0 annot-version=v1.0
ATGGTTTACCCCATTGTCGTCTTCCTTCTTCTTCTTCTATGGACCTCATTACAACACTTCGTCCATGCCGATTTCCCAACCACTCTTCAAGGTCCCTTCA
AGCCCTTTTCTGCACCTCTTGCTGCTAAATACTTCAATGACAAGTCAATCGATTTGCCTTCCAATGACTCCCAAGTTGAGAGGACTGTTAAGGGTTTCCA
GCCTGAACAAATCTTCCTCTCCCTCTCTTCCAACTACAACTCCGTTTGGGTCTCCTGGGTCACAGGGGATTCCAATGTTGTTTACGACGATCCTGACTCA
ATTGCCAGTGTAGTTCAATATGGGGTTTCCAGGTCACCAATGGACCATAAAGCACTTGGCTATTCCCTCGTTTACTCTCAGCTTTATCCTTACGACGCCC
TTCATAACTACACATCCGGAATCATACACCACGTTCGCCTCACAGGATTGGAACCTGAAACACTGTACCAATATCGATGTGGAGATCCTCACATTCGAGC
AATGAGTGATGTGTTTTACTTCAGGACAATGCCACTTCCTAACCCCACAAATTATCCAGCCAGAATAGCAGTGGTGGGAGATTTAGGACTCACTATCAAT
ACCAGCACAACAGTTGACCATATTCTCAGCAATGATCCTGATTTGGTTGTCTTAGTTGGGGTTTTAAGTTATGCTGATATGTATCTAAATGGAACTGGCT
CTGATTGTTATGCTTGCTCCTTCCCCGACACTCCTATCCATGAAACTTACGAGCCTCGTTGGGATGACTGGGGAAGGTTTATGCAGCCTCTCACAGCTAA
TGTCCCTACAATGGTTATAGGAGGAAAACATGAGATAGAACCACAGGTTGATGATCAGATATTTGTTTCTTACAGCTACAGATTTGCATTCCCGTATGAC
GGAATTGGATCATCCTCCCCGCTCCATTACTCTTTCAAGGCAGGAGGGATACATTTTGTTTTGCCCAGTCCCTACACTCCTTATGACACATCATGTACGC
AAGCTTTTCCCTCAAGCTTTTGA
AA sequence
>Lus10007119 pacid=23139745 polypeptide=Lus10007119 locus=Lus10007119.g ID=Lus10007119.BGIv1.0 annot-version=v1.0
MVYPIVVFLLLLLWTSLQHFVHADFPTTLQGPFKPFSAPLAAKYFNDKSIDLPSNDSQVERTVKGFQPEQIFLSLSSNYNSVWVSWVTGDSNVVYDDPDS
IASVVQYGVSRSPMDHKALGYSLVYSQLYPYDALHNYTSGIIHHVRLTGLEPETLYQYRCGDPHIRAMSDVFYFRTMPLPNPTNYPARIAVVGDLGLTIN
TSTTVDHILSNDPDLVVLVGVLSYADMYLNGTGSDCYACSFPDTPIHETYEPRWDDWGRFMQPLTANVPTMVIGGKHEIEPQVDDQIFVSYSYRFAFPYD
GIGSSSPLHYSFKAGGIHFVLPSPYTPYDTSCTQAFPSSF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07130 ATPAP15, PAP15 purple acid phosphatase 15 (.1... Lus10007119 0 1
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10008936 3.6 0.8301
AT3G10720 Plant invertase/pectin methyle... Lus10008937 7.6 0.8141
AT1G17810 BETA-TIP beta-tonoplast intrinsic prote... Lus10018256 7.7 0.7558
AT5G04970 Plant invertase/pectin methyle... Lus10028882 10.2 0.8037
AT4G34260 AXY8, FUC95A ALTERED XYLOGLUCAN 8, 1,2-alph... Lus10026595 11.0 0.8074
AT1G75620 glyoxal oxidase-related protei... Lus10024312 11.5 0.8133
AT3G04120 GAPC1, GAPC-1, ... glyceraldehyde-3-phosphate deh... Lus10032071 12.4 0.7352
AT3G55120 A11, CFI, TT5 TRANSPARENT TESTA 5, CHALCONE ... Lus10030310 17.4 0.7447
AT5G40780 LHT1, LTH1 lysine histidine transporter 1... Lus10032073 19.2 0.7711
AT5G10770 Eukaryotic aspartyl protease f... Lus10020099 19.9 0.7955

Lus10007119 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.