Lus10007122 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039420 80 / 1e-20 ND /
Lus10016668 44 / 8e-07 AT3G24100 61 / 3e-14 Uncharacterised protein family SERF (.1)
Lus10010589 37 / 0.0007 ND /
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04419 4F5 4F5 protein related disordered region
Representative CDS sequence
>Lus10007122 pacid=23139755 polypeptide=Lus10007122 locus=Lus10007122.g ID=Lus10007122.BGIv1.0 annot-version=v1.0
ATGGAGCTAGAGCTGCAGTTTAACATTCCCGGGCCTGTGTTCGATTTTGGATTTACGGATGTTAGTGGGACACAGCAGAGTGCAGAGCAGATACTAGATA
GTATCACTGCAGGATCGCCACCGAACATCGATGACATCAGAGATGATTCGGAGAGCTCGGGCGATGACCAGCCTGATGATGATCAGCATGATCCTCCATT
TCACCCAGCCCTTTTAAGGGAGCGTGATCGCGACAGAGCTAATGCTCGCAACCCTAAGGGCGGCAAGGGCAAGGACGACGGCTTGACCCCTGAACAACGC
CGCGAGAGGGACGCCAAGGCGCTGCAAGAGAAGGCGGCGAAGAAAGCCGCGCAGGGTTCCGGAGGAAATTCTTCCGGAGGTAAAGGAGACACCAAGAAAT
AA
AA sequence
>Lus10007122 pacid=23139755 polypeptide=Lus10007122 locus=Lus10007122.g ID=Lus10007122.BGIv1.0 annot-version=v1.0
MELELQFNIPGPVFDFGFTDVSGTQQSAEQILDSITAGSPPNIDDIRDDSESSGDDQPDDDQHDPPFHPALLRERDRDRANARNPKGGKGKDDGLTPEQR
RERDAKALQEKAAKKAAQGSGGNSSGGKGDTKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G24100 Uncharacterised protein family... Lus10007122 0 1
AT5G40250 RING/U-box superfamily protein... Lus10014526 2.6 0.7998
AT5G50460 secE/sec61-gamma protein trans... Lus10035206 4.6 0.7765
AT1G11360 Adenine nucleotide alpha hydro... Lus10031594 8.0 0.7812
AT5G36290 Uncharacterized protein family... Lus10020195 14.0 0.7188
AT2G24765 ARF3, ARL1, ATA... ARF-LIKE 1, ADP-ribosylation f... Lus10026910 14.5 0.7232
Lus10017454 17.1 0.7391
AT3G24100 Uncharacterised protein family... Lus10016668 17.3 0.7729
AT2G17390 AKR2B ankyrin repeat-containing 2B (... Lus10013859 19.6 0.7163
AT1G79340 AtMCP2d, ATMC4 metacaspase 2d, metacaspase 4 ... Lus10001835 20.7 0.7332
AT2G18040 PIN1AT "peptidylprolyl cis/trans isom... Lus10014266 23.6 0.7259

Lus10007122 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.