Lus10007126 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G08690 128 / 2e-38 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT5G56150 126 / 2e-37 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT5G41700 125 / 4e-37 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT2G16740 125 / 4e-37 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT5G53300 124 / 8e-37 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT1G64230 124 / 9e-37 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT4G27960 123 / 2e-36 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT3G08700 118 / 3e-34 UBC12 ubiquitin-conjugating enzyme 12 (.1)
AT3G13550 106 / 3e-29 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2)
AT1G78870 98 / 2e-26 UBC35 ,UBC13A UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016670 269 / 2e-93 AT5G56150 149 / 1e-46 ubiquitin-conjugating enzyme 30 (.1.2)
Lus10028700 130 / 6e-39 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10009422 130 / 6e-39 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10022726 124 / 1e-36 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014187 124 / 1e-36 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10032352 124 / 2e-36 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10027570 122 / 5e-36 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 122 / 5e-36 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014942 122 / 6e-36 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G055300 139 / 5e-42 AT5G56150 183 / 9e-60 ubiquitin-conjugating enzyme 30 (.1.2)
Potri.011G168200 128 / 2e-38 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.019G083800 128 / 3e-38 AT5G56150 280 / 1e-98 ubiquitin-conjugating enzyme 30 (.1.2)
Potri.001G471200 127 / 6e-38 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.019G131400 125 / 4e-37 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.003G136200 124 / 7e-37 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.006G110200 124 / 8e-37 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.016G138900 124 / 9e-37 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.015G023300 122 / 5e-36 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.012G033000 122 / 5e-36 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10007126 pacid=23139739 polypeptide=Lus10007126 locus=Lus10007126.g ID=Lus10007126.BGIv1.0 annot-version=v1.0
ATGGCAGTCTTCTCTGGGCTCAAACTTTTCAGTAGCAAATCCTCCATCAGGAAATCAAAAAAGACCACACCAGAGCGCAGACTCGACAAGGAAATAAAGC
GGGCAAGAGATCACAACATTCCATCCCACTGCAGCTTTGGACCTGCTGAAGATGGTGATGACATCTACAAGCTTCAAGGTGCCATCTTTGGTCCAGCTCA
AACACCTTATGAAGGTGGTGTCTTCCTCTTGTCCATCCGTATTCCCAAAAGCTACCCTTTCACCCCTCCAAAGATCAACTTCATCACCAAGGTTTATCAC
CCAAACGTGAGACGAGATGGGAGGATTGAAGTGGATATTCTGGGGAATAACTGGACACCTGCCTTGACAATTGAGAAGCTGTTACTGTCAATTTGCTCAA
TGCTTCCAGACCCAGATCCTGATGCTGATTCTCCACTCAATAATCCTGCTGCTGCCCTCTATCTATCTGATCTCAAATCTTTCAACAGGAAAGCCAGGGA
ATGGACTCTCAAATATGCAATTCTCTGA
AA sequence
>Lus10007126 pacid=23139739 polypeptide=Lus10007126 locus=Lus10007126.g ID=Lus10007126.BGIv1.0 annot-version=v1.0
MAVFSGLKLFSSKSSIRKSKKTTPERRLDKEIKRARDHNIPSHCSFGPAEDGDDIYKLQGAIFGPAQTPYEGGVFLLSIRIPKSYPFTPPKINFITKVYH
PNVRRDGRIEVDILGNNWTPALTIEKLLLSICSMLPDPDPDADSPLNNPAAALYLSDLKSFNRKAREWTLKYAIL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G08690 ATUBC11, UBC11 ubiquitin-conjugating enzyme 1... Lus10007126 0 1
AT5G56150 UBC30 ubiquitin-conjugating enzyme 3... Lus10016670 1.0 0.9222
AT3G61920 unknown protein Lus10002686 2.0 0.8802
AT1G61667 Protein of unknown function, D... Lus10020075 2.0 0.8879
AT4G25440 C3HZnF ZFWD1 zinc finger WD40 repeat protei... Lus10021655 5.3 0.8688
AT4G30440 GAE1 UDP-D-glucuronate 4-epimerase ... Lus10008893 7.1 0.8862
AT4G24060 DOF AtDof4,6 Dof-type zinc finger DNA-bindi... Lus10003208 8.5 0.8611
AT4G00880 SAUR-like auxin-responsive pro... Lus10032949 9.2 0.8736
AT4G22250 RING/U-box superfamily protein... Lus10035335 9.8 0.8544
AT2G27260 Late embryogenesis abundant (L... Lus10005216 10.0 0.8770
AT2G30360 PKS5, CIPK11, S... SNF1-RELATED PROTEIN KINASE 3.... Lus10022748 10.2 0.8598

Lus10007126 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.