Lus10007137 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48760 384 / 5e-138 Ribosomal protein L13 family protein (.1.2)
AT4G13170 379 / 4e-136 Ribosomal protein L13 family protein (.1)
AT3G07110 379 / 7e-136 Ribosomal protein L13 family protein (.1.2)
AT3G24830 378 / 1e-135 Ribosomal protein L13 family protein (.1)
AT1G78630 53 / 2e-08 EMB1473 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016679 414 / 1e-149 AT5G48760 386 / 9e-139 Ribosomal protein L13 family protein (.1.2)
Lus10043151 412 / 3e-149 AT5G48760 380 / 2e-136 Ribosomal protein L13 family protein (.1.2)
Lus10032599 412 / 3e-149 AT5G48760 380 / 2e-136 Ribosomal protein L13 family protein (.1.2)
Lus10011857 392 / 6e-141 AT5G48760 394 / 8e-142 Ribosomal protein L13 family protein (.1.2)
Lus10022793 389 / 1e-139 AT5G48760 390 / 2e-140 Ribosomal protein L13 family protein (.1.2)
Lus10005553 46 / 5e-06 AT1G78630 332 / 8e-116 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G314500 390 / 2e-140 AT5G48760 384 / 7e-138 Ribosomal protein L13 family protein (.1.2)
Potri.017G054600 385 / 1e-138 AT5G48760 351 / 5e-125 Ribosomal protein L13 family protein (.1.2)
Potri.002G242600 371 / 8e-133 AT4G13170 357 / 4e-127 Ribosomal protein L13 family protein (.1)
Potri.001G384600 50 / 2e-07 AT1G78630 351 / 1e-123 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Potri.011G106100 49 / 4e-07 AT1G78630 342 / 3e-120 embryo defective 1473, Ribosomal protein L13 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00572 Ribosomal_L13 Ribosomal protein L13
Representative CDS sequence
>Lus10007137 pacid=23139757 polypeptide=Lus10007137 locus=Lus10007137.g ID=Lus10007137.BGIv1.0 annot-version=v1.0
ATGGTGTCCGGATCAGGGATATGCGCCAAGAGGGTGGTCGTCGATGCACGCCACCACATGCTCGGCCGCCTCTCTTCTATCATAGCCAAGGAGCTCTTGA
ATGGCCAGAAGGTTGTCGTCGTCCGCTGCGAGGAAATTTGTATGTCCGGCGGACTGGTCCGCCAGAAAATGAAGTATATGAGGTTCCTGAGGAAGCGCAT
GAACACCAAGCCTTCTCACGGGCCCATTCATTTCCGCGCCCCTTCCAAGATCCTCTGGCGCACAATCCGTGGCATGATTCCTCACAAGACCAAGCGTGGT
GAGGCTGCTCTCGCCAGGTTGAAGGTCTATGATGGTGTCCCCCCGCCCTACGACAAGGTTAAGAGGATGGTTATCCCCGACGCTCTAAAGGTTTTGAGGT
TGCAGAGTGGACACAAGTACTGCTTGTTGGGGAAACTCTCATCTGAAGTTGGATGGAACTACTATGATACCATTAAGGAGCTTGAGAGCAGGAGGAAGGA
GAAGGCAGCAGTAGTGTACGAGAGAAAGAAGCAGTTGGCTAAACTGAGGGTTAAGGCTGAGAAGACCGCCGATGAGAAGCTTGGTGATCAGCTTGATGTC
ATTGCTCCCATCAAATATTGA
AA sequence
>Lus10007137 pacid=23139757 polypeptide=Lus10007137 locus=Lus10007137.g ID=Lus10007137.BGIv1.0 annot-version=v1.0
MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG
EAALARLKVYDGVPPPYDKVKRMVIPDALKVLRLQSGHKYCLLGKLSSEVGWNYYDTIKELESRRKEKAAVVYERKKQLAKLRVKAEKTADEKLGDQLDV
IAPIKY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G48760 Ribosomal protein L13 family p... Lus10007137 0 1
AT4G36130 Ribosomal protein L2 family (.... Lus10041923 1.4 0.9688
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10032918 1.7 0.9640
AT1G74050 Ribosomal protein L6 family pr... Lus10038775 2.0 0.9637
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Lus10005586 2.0 0.9656
AT3G49910 Translation protein SH3-like f... Lus10028537 3.2 0.9623
AT1G23290 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Riboso... Lus10016336 3.5 0.9621
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Lus10013719 4.0 0.9480
AT5G09500 Ribosomal protein S19 family p... Lus10024865 4.2 0.9470
AT5G48760 Ribosomal protein L13 family p... Lus10016679 4.6 0.9536
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10006207 5.5 0.9340

Lus10007137 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.