Lus10007142 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG01280 84 / 3e-19 ATCG01280.1, YCF2.2 Chloroplast Ycf2;ATPase, AAA type, core (.1)
ATCG00860 84 / 3e-19 ATCG00860.1, YCF2.1 Chloroplast Ycf2;ATPase, AAA type, core (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002548 226 / 3e-69 ATCG01280 829 / 0.0 Chloroplast Ycf2;ATPase, AAA type, core (.1)
Lus10026434 63 / 4e-13 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G143400 87 / 1e-20 ATCG01280 3894 / 0.0 Chloroplast Ycf2;ATPase, AAA type, core (.1)
Potri.019G028400 86 / 6e-20 ATCG01280 928 / 0.0 Chloroplast Ycf2;ATPase, AAA type, core (.1)
PFAM info
Representative CDS sequence
>Lus10007142 pacid=23175295 polypeptide=Lus10007142 locus=Lus10007142.g ID=Lus10007142.BGIv1.0 annot-version=v1.0
ATGATAAAAAATGGATCTTTTTCTATCCTTGAAAAGAGATTTTTCCACAAATTGGTGTTTGAACAACAAGCGGCAGAAGAAGAAAGAGCCCTCGACCCGC
TACAGATAGTAGCAGAGGATTTATTCACTGACATAGTTTGGTCTCCTAGAATATGGCACTCTTGGGTAATTCTATTTTATTGTATCAAAAGGCTCAATGA
ATTAGGATTTCCCTATGGGTCCAAGTTATATCCGAGCAAGGGGAACATTTATGATGAGATTTATGATGAAGAGGGTGATCTTCGAGAGAAGGTTGAAGAG
GATAATCTTGATGACATTTATGAGAAATATAGGAAGGGTGATCTTCAAGAGAATGATGAAGACGATGAGCTTCAAGAGAATGATGAAGAGTTCTTGCAGA
GTGCAACCATGCAGTGCCAGATGCGATATGGATCTGCCAACGAACGGGGCTTTTTTTGA
AA sequence
>Lus10007142 pacid=23175295 polypeptide=Lus10007142 locus=Lus10007142.g ID=Lus10007142.BGIv1.0 annot-version=v1.0
MIKNGSFSILEKRFFHKLVFEQQAAEEERALDPLQIVAEDLFTDIVWSPRIWHSWVILFYCIKRLNELGFPYGSKLYPSKGNIYDEIYDEEGDLREKVEE
DNLDDIYEKYRKGDLQENDEDDELQENDEEFLQSATMQCQMRYGSANERGFF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
ATCG01280 ATCG01280.1, YC... Chloroplast Ycf2;ATPase, AAA t... Lus10007142 0 1
Lus10033844 1.0 0.8649
AT1G27750 nucleic acid binding (.1) Lus10007756 3.5 0.8039
AT3G08040 ATFRD3, MAN1, F... MANGANESE ACCUMULATOR 1, FERRI... Lus10039609 4.9 0.8354
ATCG00680 ATCG00680.1, PS... photosystem II reaction center... Lus10006593 6.2 0.8479
Lus10024939 6.7 0.8146
AT4G02350 SEC15B exocyst complex component sec1... Lus10009857 6.8 0.8545
Lus10002802 7.1 0.7188
ATCG00680 ATCG00680.1, PS... photosystem II reaction center... Lus10001686 7.2 0.8461
AT3G51480 ATGLR3.6 glutamate receptor 3.6 (.1) Lus10035980 7.7 0.7865
AT1G60990 Glycine cleavage T-protein fam... Lus10020818 7.7 0.8087

Lus10007142 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.