Lus10007155 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G46940 253 / 2e-86 DUT1 DUTP-PYROPHOSPHATASE-LIKE 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010809 350 / 6e-124 AT3G46940 271 / 2e-93 DUTP-PYROPHOSPHATASE-LIKE 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G261900 261 / 8e-89 AT3G46940 259 / 6e-89 DUTP-PYROPHOSPHATASE-LIKE 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0153 dUTPase PF00692 dUTPase dUTPase
Representative CDS sequence
>Lus10007155 pacid=23140465 polypeptide=Lus10007155 locus=Lus10007155.g ID=Lus10007155.BGIv1.0 annot-version=v1.0
ATGGCGGGATCTTCCTTCCCTTTATATAAACGATCACCCACGTACGCTGCTGCTTCCTCACAGTATTTCCAAGCCTCACTTTTCCGCAAACCCATTATTT
CTCCAACGCTCCTCAAGGAAATGTCTCAACAAGCTGAGATCCAGAATGGAAGTCCTGAAGTCCAGGAGCCCTCGCCCAAGATCCCCAAGCTGGACCACCA
GAACGGTGTCCATGTCGCCGCCTCTTTCTTCTTCAAGGTGAAGAAGCTCTCCGAAAAGGCTGTCTTGCCCACCAGAGGCTCTCCTCTCTCCGCCGGCTAC
GATCTTTCCAGTGCGGCGGAAATGAAAGTGCCGGCGAGGGGAAAAGCCCTTATCCCAACGGACCTGAGCATCGCAGTGCCAGAAGGAGCATATGCTCGGA
TCGCTCCGAGATCGGGACTGGCATGGAAGCACTCGATCGACGTTGGAGCGGGAGTGGTAGATGCAGACTACAGAGGTCCGGTTGGGGTGATACTGTTCAA
CTACTCGGACGTTGACTTTGAAGTCAAACAGGGCGATAGAATTGCACAGCTTATCATCGAGAGGATCATTACTCCGGAGGTTTTGGAAGTGGAAGATCTG
GACGTCACCGTCAGAGGCGAAGGAGGCTTTGGTTCCACCGGCGTCTGA
AA sequence
>Lus10007155 pacid=23140465 polypeptide=Lus10007155 locus=Lus10007155.g ID=Lus10007155.BGIv1.0 annot-version=v1.0
MAGSSFPLYKRSPTYAAASSQYFQASLFRKPIISPTLLKEMSQQAEIQNGSPEVQEPSPKIPKLDHQNGVHVAASFFFKVKKLSEKAVLPTRGSPLSAGY
DLSSAAEMKVPARGKALIPTDLSIAVPEGAYARIAPRSGLAWKHSIDVGAGVVDADYRGPVGVILFNYSDVDFEVKQGDRIAQLIIERIITPEVLEVEDL
DVTVRGEGGFGSTGV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G46940 DUT1 DUTP-PYROPHOSPHATASE-LIKE 1 (.... Lus10007155 0 1
AT3G48710 DEK domain-containing chromati... Lus10016746 1.4 0.9028
AT1G78650 POLD3 DNA-directed DNA polymerases (... Lus10039192 4.7 0.8947
AT3G13960 GRF ATGRF5 growth-regulating factor 5 (.1... Lus10004455 4.9 0.8763
AT3G48710 DEK domain-containing chromati... Lus10022439 8.5 0.8850
AT5G20510 Alfin AL5 alfin-like 5 (.1) Lus10037655 9.5 0.8670
AT5G20510 Alfin AL5 alfin-like 5 (.1) Lus10015637 9.8 0.8508
AT1G50660 unknown protein Lus10043111 9.9 0.8460
AT5G35390 Leucine-rich repeat protein ki... Lus10027597 10.9 0.7907
AT2G20980 MCM10 minichromosome maintenance 10 ... Lus10014124 11.1 0.8146
AT3G48710 DEK domain-containing chromati... Lus10025759 11.4 0.8738

Lus10007155 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.