Lus10007156 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G65650 135 / 3e-41 Protein of unknown function (DUF1195) (.1)
AT4G36660 134 / 7e-41 Protein of unknown function (DUF1195) (.1)
AT1G19380 106 / 5e-30 Protein of unknown function (DUF1195) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010810 225 / 1e-76 AT4G36660 152 / 3e-47 Protein of unknown function (DUF1195) (.1)
Lus10014322 134 / 1e-40 AT5G65650 244 / 3e-83 Protein of unknown function (DUF1195) (.1)
Lus10026030 128 / 4e-38 AT4G36660 239 / 1e-81 Protein of unknown function (DUF1195) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G027700 141 / 1e-43 AT5G65650 206 / 2e-68 Protein of unknown function (DUF1195) (.1)
Potri.005G125000 137 / 4e-42 AT5G65650 204 / 1e-67 Protein of unknown function (DUF1195) (.1)
Potri.014G181600 133 / 3e-40 AT4G36660 157 / 4e-49 Protein of unknown function (DUF1195) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06708 DUF1195 Protein of unknown function (DUF1195)
Representative CDS sequence
>Lus10007156 pacid=23140468 polypeptide=Lus10007156 locus=Lus10007156.g ID=Lus10007156.BGIv1.0 annot-version=v1.0
ATGAAAGACACTATATCTCCCTCTGAAGCTCCCCTTCTCCCCACCACCTCTGCAAGGAGAGACAACCCTGATTCCAAAAGTGCTTACAAGTTGTGGGTCA
TCTCCCTACTCCTCCTCCTTGCTTTCTGGTCCATGCTCACCGGCACCGTCACTCTCAAATGGTCTACTGGTAGCCTCACCCGTCTTTCCGACGAACTCGA
CATACCCATCCACTATGATTTCGACGTCCTCGAAGTTGCGGAGAGCGAGAAAGTGGTGAAGCATATGTGGGATGTTTATATGCAGAGCAGCAGCAGCAGT
AAGAGGAGACTGCCTCGTTTCTGGGAAGAAGCTTTCGAAGCTGGTTACGAGGCTTTGGCTAGTGATTTGGCTGCTGTTCGTGATTCTGCTGTTTCTGAGA
TCGCCAAGATGTCTCTTTTCTCTGCCGAGCAGCACCCTATGTAA
AA sequence
>Lus10007156 pacid=23140468 polypeptide=Lus10007156 locus=Lus10007156.g ID=Lus10007156.BGIv1.0 annot-version=v1.0
MKDTISPSEAPLLPTTSARRDNPDSKSAYKLWVISLLLLLAFWSMLTGTVTLKWSTGSLTRLSDELDIPIHYDFDVLEVAESEKVVKHMWDVYMQSSSSS
KRRLPRFWEEAFEAGYEALASDLAAVRDSAVSEIAKMSLFSAEQHPM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G36660 Protein of unknown function (D... Lus10007156 0 1
AT4G36660 Protein of unknown function (D... Lus10010810 1.0 0.8702
AT5G53310 myosin heavy chain-related (.1... Lus10039322 2.0 0.8104
AT5G50000 Protein kinase superfamily pro... Lus10002368 2.8 0.7620
AT4G40010 SNRK2-7, SNRK2.... SUCROSE NONFERMENTING 1-RELATE... Lus10015676 5.3 0.7853
AT3G59350 Protein kinase superfamily pro... Lus10025496 5.5 0.7958
AT1G61560 ATMLO6, MLO6 MILDEW RESISTANCE LOCUS O 6, S... Lus10041410 14.5 0.7616
AT5G52430 hydroxyproline-rich glycoprote... Lus10039253 14.9 0.7405
AT5G10290 leucine-rich repeat transmembr... Lus10023146 17.1 0.7428
AT1G15060 Uncharacterised conserved prot... Lus10043481 19.4 0.7451
AT5G52210 ATGB1, ATARLB1 GTP-binding protein 1 (.1.2) Lus10038871 20.1 0.7054

Lus10007156 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.