Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30942 95 / 3e-28 Protein of unknown function (DUF3317) (.1) AT1G06515 87 / 3e-25 Protein of unknown function (DUF3317) (.1), Protein of unknown function (DUF3317) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010818 [exp] 60 / 1e-13 AT1G15510 65 / 2e-15 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G263100 [exp] 99 / 8e-30 AT2G30942 100 / 5e-30 Protein of unknown function (DUF3317) (.1) Potri.001G000400 [exp] 98 / 3e-29 AT2G30942 98 / 2e-29 Protein of unknown function (DUF3317) (.1) Potri.002G263300 [exp] 98 / 3e-29 AT2G30942 98 / 3e-29 Protein of unknown function (DUF3317) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11779 [flax] [poplar] SPT_ssu-like Small subunit of serine palmitoyltransferase-like
Representative CDS sequence Show only first row Show all	>Lus10007167 pacid=23140459 polypeptide=Lus10007167 locus=Lus10007167.g ID=Lus10007167.BGIv1.0 annot-version=v1.0 ATGAACTTGATTCAACGGAAGATCTATCTCTATAATGTCACTTTCGGGCTTTACATGTTGGATTGGTGGGAGCGTTACCTGTTCAATATCTTGGTGCTTG TGTTGATGTGGTTCATCTTCTACAACGGGTCACGATACATAACAGAGTTCTGCAAGAGGTAA
AA sequence Show only first row Show all	>Lus10007167 pacid=23140459 polypeptide=Lus10007167 locus=Lus10007167.g ID=Lus10007167.BGIv1.0 annot-version=v1.0 MNLIQRKIYLYNVTFGLYMLDWWERYLFNILVLVLMWFIFYNGSRYITEFCKR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G30942			Protein of unknown function (D...		Lus10007167 [exp]	0	1
AT2G41950			unknown protein		Lus10016243 [exp]	2.8	0.8539
AT3G05870		APC11	anaphase-promoting complex/cyc...		Lus10015126 [exp]	4.2	0.8497
AT5G05670			signal recognition particle bi...		Lus10030593 [exp]	4.6	0.7651
AT3G25210			Tetratricopeptide repeat (TPR)...		Lus10038215 [exp]	8.7	0.8417
AT3G11750		FOLB1	Dihydroneopterin aldolase (.1)		Lus10013600 [exp]	12.2	0.8105
AT3G10670		ABCI6, ATNAP7	ATP-binding cassette I6, non-i...		Lus10043429 [exp]	14.5	0.7543
AT1G29990		PFD6, PDF6	prefoldin 6 (.1)		Lus10038496 [exp]	20.6	0.7923
AT3G52440	DOF	AtDof3,5	Dof-type zinc finger DNA-bindi...		Lus10013586 [exp]	23.0	0.7629
AT5G47320		RPS19	ribosomal protein S19 (.1)		Lus10027711 [exp]	26.2	0.8035
AT5G56670			Ribosomal protein S30 family p...		Lus10017473 [exp]	27.1	0.8054

Compare expression of checked genes

Lus10007167 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.