Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016310 [exp] 46 / 8e-07 AT1G75130 596 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Lus10010821 [exp] 0 / 1 AT1G75130 522 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007169 pacid=23140462 polypeptide=Lus10007169 locus=Lus10007169.g ID=Lus10007169.BGIv1.0 annot-version=v1.0 ATGGAGCGAGTCAAGGAATGGGTGCCAGAGAAAGTGAATTGCACGAAAAAGATGTTGGAAAACTTGAGGAGATACAAGGAGAAAGAGAAGATTTTGAGGT CGACGTTCACAAAGAGTTCCACCAACTGTCAGCTGATGTCATATCAAGAACAACACTCGGGAGCAGCTTCGAACAAGGAAAACGAATCTTCGCACTCCAG GACCGGCAAGCCCAGCTCGCTGCTCAGGCGATCGGCAGCGTCTACATTCCTGGCTTCAGGTTTCTCCCCACCAAAAAGAACAGGGAGAGGTGAAGATTGG AAAAGGAAACACGAGATTCCATCAGGGCGTTGA
AA sequence Show only first row Show all	>Lus10007169 pacid=23140462 polypeptide=Lus10007169 locus=Lus10007169.g ID=Lus10007169.BGIv1.0 annot-version=v1.0 MERVKEWVPEKVNCTKKMLENLRRYKEKEKILRSTFTKSSTNCQLMSYQEQHSGAASNKENESSHSRTGKPSSLLRRSAASTFLASGFSPPKRTGRGEDW KRKHEIPSGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10007169 [exp]	0	1
AT5G56680		SYNC1ARATH, SYN...	EMBRYO DEFECTIVE 2755, Class I...		Lus10008180 [exp]	3.9	0.8068
AT1G31550			GDSL-like Lipase/Acylhydrolase...		Lus10026550 [exp]	4.0	0.8690
					Lus10005843 [exp]	5.8	0.8683
					Lus10022511 [exp]	7.1	0.8683
AT2G36690			2-oxoglutarate (2OG) and Fe(II...		Lus10024231 [exp]	8.2	0.8683
AT4G21390		B120	S-locus lectin protein kinase ...		Lus10032836 [exp]	9.2	0.8683
AT2G01260			Protein of unknown function (D...		Lus10041982 [exp]	9.3	0.6605
AT5G17490	GRAS	AtRGL3, RGL3	RGA-like protein 3 (.1)		Lus10002424 [exp]	10.1	0.8683
AT1G01580		FRD1, ATFRO2, F...	FERRIC CHELATE REDUCTASE DEFEC...		Lus10036381 [exp]	10.9	0.8683
					Lus10010827 [exp]	11.7	0.8683

Compare expression of checked genes

Lus10007169 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.