Lus10007179 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000406 80 / 8e-20 ND /
Lus10002502 42 / 2e-05 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10007179 pacid=23162065 polypeptide=Lus10007179 locus=Lus10007179.g ID=Lus10007179.BGIv1.0 annot-version=v1.0
ATGTCGACTATGCTCAATGTGAAGCCGAACCATCAAGCTCGCCACCCATCAAGCACCACTACCTGGAAGCCTCCACAAAAGCTACTAAACGACCAAGGTC
GGAGCCTCACTTGCACTGTTCAAGGCCTAACTCACGTCCGAGTCATCCCAGGATCAACTATGAAACCTGATCTCATGCTCACCATTGTCTGTAACGTTAC
TAACTACCACTCATTTCCATTCCTCATGCATCACGCTTACGATCTTCTAAACCATGCTCGTGCTAGTTCTCTGGCCATGCCCGTCGTGGCTTACACTGTC
ACATATGGTGTCGACATACCAACCATGGTAGTGCCCCTCGACACCACACCCGTGATCCACTGA
AA sequence
>Lus10007179 pacid=23162065 polypeptide=Lus10007179 locus=Lus10007179.g ID=Lus10007179.BGIv1.0 annot-version=v1.0
MSTMLNVKPNHQARHPSSTTTWKPPQKLLNDQGRSLTCTVQGLTHVRVIPGSTMKPDLMLTIVCNVTNYHSFPFLMHHAYDLLNHARASSLAMPVVAYTV
TYGVDIPTMVVPLDTTPVIH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10007179 0 1
AT2G18370 Bifunctional inhibitor/lipid-t... Lus10001431 3.5 1.0000
AT5G14400 CYP724A1 "cytochrome P450, family 724, ... Lus10003650 4.0 1.0000
Lus10003840 6.0 1.0000
Lus10012429 6.7 1.0000
Lus10005396 6.9 1.0000
AT5G48540 receptor-like protein kinase-r... Lus10015472 7.9 1.0000
Lus10022573 8.5 1.0000
AT3G05950 RmlC-like cupins superfamily p... Lus10029010 8.5 1.0000
AT1G76140 Prolyl oligopeptidase family p... Lus10019994 9.2 0.9293
Lus10006661 10.4 1.0000

Lus10007179 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.