Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000298 [exp] 166 / 1e-55 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G224210 [exp] 117 / 9e-36 ND / Potri.014G185804 [exp] 117 / 9e-36 ND / Potri.014G186452 [exp] 117 / 9e-36 ND / Potri.014G185588 [exp] 117 / 9e-36 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007186 pacid=23162071 polypeptide=Lus10007186 locus=Lus10007186.g ID=Lus10007186.BGIv1.0 annot-version=v1.0 ATGGAACAATGTAGGCAAGGGAAGTCGGCAAAATGGATCCGTAACTTCGGGAAAAGGATTGGCTCTGAGGGCTGGGCCCGGGGGTCCCAGTCCCGAACCC GTCGGCTGTCGGCGGACTGCTCGAGCTGCTCCCGCGGCGAGAGCGGGTCGCTGCGTGCCGGCAGGGGGACGGGCTGGGAACGGTCCCTTCACGGAGGCCT TCCCCGGGCGTCGAACAGCCAGCTCAGAACTGGCACGGACAAGGGGAATCCGACTGTTTAA
AA sequence Show only first row Show all	>Lus10007186 pacid=23162071 polypeptide=Lus10007186 locus=Lus10007186.g ID=Lus10007186.BGIv1.0 annot-version=v1.0 MEQCRQGKSAKWIRNFGKRIGSEGWARGSQSRTRRLSADCSSCSRGESGSLRAGRGTGWERSLHGGLPRASNSQLRTGTDKGNPTV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10007186 [exp]	0	1
					Lus10000298 [exp]	1.0	0.9935
					Lus10039450 [exp]	1.7	0.9384
					Lus10008011 [exp]	2.0	0.9662
					Lus10001550 [exp]	8.5	0.9089
AT4G30550		GGP3	gamma-glutamyl peptidase 3, Cl...		Lus10015493 [exp]	12.5	0.9273
					Lus10018837 [exp]	13.9	0.9205
					Lus10009927 [exp]	15.4	0.9185
					Lus10017955 [exp]	15.5	0.9250
					Lus10039496 [exp]	17.5	0.9141
AT5G62575		SDH7B, SDH7	succinate dehydrogenase 7B, su...		Lus10034122 [exp]	18.7	0.7809

Compare expression of checked genes

Lus10007186 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.