Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17210 44 / 4e-07 Protein of unknown function (DUF1218) (.1), Protein of unknown function (DUF1218) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010077 [exp] 72 / 1e-17 AT5G17210 263 / 8e-90 Protein of unknown function (DUF1218) (.1), Protein of unknown function (DUF1218) (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G048300 [exp] 59 / 1e-12 AT5G17210 188 / 1e-60 Protein of unknown function (DUF1218) (.1), Protein of unknown function (DUF1218) (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007189 pacid=23167606 polypeptide=Lus10007189 locus=Lus10007189.g ID=Lus10007189.BGIv1.0 annot-version=v1.0 ATGGAGAGAAAGACAATATTGCTTTGCAGCGTTGTCGCCCTTCTCGGTTTGCTCTCAGCTTCCACTGGTTTCGCTGCAGAAGCCACCCGGATCAAGGGTT CACAAGTTCAGTTCACAACCACAACGCAGTGTGCCTATCCCAGGAGCCCTGCATCAGGCTAA
AA sequence Show only first row Show all	>Lus10007189 pacid=23167606 polypeptide=Lus10007189 locus=Lus10007189.g ID=Lus10007189.BGIv1.0 annot-version=v1.0 MERKTILLCSVVALLGLLSASTGFAAEATRIKGSQVQFTTTTQCAYPRSPASG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G17210			Protein of unknown function (D...		Lus10007189 [exp]	0	1
AT3G21215			RNA-binding (RRM/RBD/RNP motif...		Lus10034844 [exp]	4.0	0.7931
AT5G63260	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Lus10043330 [exp]	4.5	0.8075
AT1G43850		SEU	SEUSS transcriptional co-regul...		Lus10042785 [exp]	7.1	0.7968
AT3G09180			unknown protein		Lus10016953 [exp]	7.7	0.7872
AT4G24560		UBP16	ubiquitin-specific protease 16...		Lus10015893 [exp]	10.1	0.7797
AT2G14520			CBS domain-containing protein ...		Lus10030665 [exp]	11.2	0.7992
					Lus10039504 [exp]	15.1	0.6875
AT2G41350		AtAUG1, EMB2819	EMBRYO DEFECTIVE 2819, augmin ...		Lus10034184 [exp]	19.7	0.7674
AT2G46980			unknown protein		Lus10009259 [exp]	20.0	0.7748
AT1G19220	ARF	IAA22, ARF11, A...	indole-3-acetic acid inducible...		Lus10033597 [exp]	24.4	0.7573

Compare expression of checked genes

Lus10007189 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.