Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62100 117 / 9e-34 AUX_IAA IAA30 indole-3-acetic acid inducible 30 (.1) AT2G46990 115 / 3e-33 AUX_IAA IAA20 indole-3-acetic acid inducible 20 (.1) AT3G17600 105 / 2e-29 AUX_IAA IAA31 indole-3-acetic acid inducible 31 (.1) AT4G28640 100 / 1e-26 AUX_IAA IAA11 indole-3-acetic acid inducible 11 (.1.2.3) AT2G33310 96 / 1e-24 AUX_IAA IAA13 auxin-induced protein 13 (.1.2.3) AT1G04550 91 / 6e-23 AUX_IAA BDL, IAA12 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) AT5G25890 86 / 1e-21 AUX_IAA IAR2, IAA28 IAA-ALANINE RESISTANT 2, indole-3-acetic acid inducible 28 (.1) AT3G16500 87 / 3e-21 AUX_IAA IAA26, PAP1 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) AT1G51950 86 / 6e-21 AUX_IAA IAA18 indole-3-acetic acid inducible 18 (.1) AT5G65670 84 / 9e-20 AUX_IAA IAA9 indole-3-acetic acid inducible 9 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010081 [exp] 269 / 6e-94 AT2G46990 115 / 4e-33 indole-3-acetic acid inducible 20 (.1) Lus10038025 [exp] 174 / 2e-56 AT3G62100 127 / 1e-37 indole-3-acetic acid inducible 30 (.1) Lus10009967 [exp] 172 / 8e-56 AT3G62100 128 / 2e-38 indole-3-acetic acid inducible 30 (.1) Lus10014464 [exp] 110 / 2e-29 AT2G33310 231 / 4e-75 auxin-induced protein 13 (.1.2.3) Lus10023719 [exp] 102 / 1e-26 AT2G33310 223 / 4e-72 auxin-induced protein 13 (.1.2.3) Lus10022868 [exp] 97 / 6e-25 AT4G28640 198 / 1e-62 indole-3-acetic acid inducible 11 (.1.2.3) Lus10038285 [exp] 87 / 1e-20 AT3G16500 224 / 3e-72 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) Lus10038284 [exp] 86 / 5e-20 AT3G16500 223 / 6e-71 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) Lus10025817 [exp] 84 / 8e-20 AT3G16500 231 / 1e-74 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G111700 [exp] 144 / 1e-44 AT3G62100 150 / 7e-47 indole-3-acetic acid inducible 30 (.1) Potri.002G186400 [exp] 135 / 5e-41 AT3G62100 147 / 3e-45 indole-3-acetic acid inducible 30 (.1) Potri.010G065200 [exp] 104 / 1e-27 AT2G33310 243 / 4e-80 auxin-induced protein 13 (.1.2.3) Potri.008G172400 [exp] 103 / 3e-27 AT2G33310 246 / 4e-81 auxin-induced protein 13 (.1.2.3) Potri.001G190300 [exp] 92 / 1e-22 AT3G16500 235 / 3e-76 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) Potri.013G041300 [exp] 87 / 1e-21 AT5G43700 239 / 5e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.002G045000 [exp] 86 / 2e-21 AT5G43700 236 / 5e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G053800 [exp] 86 / 3e-21 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.002G256600 [exp] 87 / 6e-21 AT4G28640 191 / 6e-60 indole-3-acetic acid inducible 11 (.1.2.3) Potri.003G048100 [exp] 86 / 2e-20 AT3G16500 224 / 4e-72 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02309 [flax] [poplar] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Lus10007193 pacid=23167585 polypeptide=Lus10007193 locus=Lus10007193.g ID=Lus10007193.BGIv1.0 annot-version=v1.0 ATGGGCAGAGGAGGAGCAAACAATCATCCTCACCTCCATTCCTCTTGTTCTTCTTCTTCCTCATCATCCACTTCTCAACTGGTCATGAGGAAAGACCTCA GCACAGACCTCAGACTCGGCAGATCAGCTGCTGCTGCAGAGGATCATGAAGGAATGTACTGTAACAGAAACCGTATCAACACTGCTACTTGCTTTGTGAA GGTTTACATGGAAGGCATACCAATTGGGAGGAAGCTAGATTTGCTGGCTTACAGCTGTTACGAGGACATGATCCGTACTGTTGATGACATGTTCGCCACC AACATTCTCTGGGATGAGATGATGGAGGGTGAGAATAGTAATTACTACAGGGATCAAGTTAATTATCATGTTTTGACGTATGAAGACAAGGAAGGGGATT GGCTCATTGTTGGAGATGTTCCCTGGGAGATGTTTGTGTCGTGTGTGAAGAGATTGAAGATCACTAGAGCAGACGGCTTGTGA
AA sequence Show only first row Show all	>Lus10007193 pacid=23167585 polypeptide=Lus10007193 locus=Lus10007193.g ID=Lus10007193.BGIv1.0 annot-version=v1.0 MGRGGANNHPHLHSSCSSSSSSSTSQLVMRKDLSTDLRLGRSAAAAEDHEGMYCNRNRINTATCFVKVYMEGIPIGRKLDLLAYSCYEDMIRTVDDMFAT NILWDEMMEGENSNYYRDQVNYHVLTYEDKEGDWLIVGDVPWEMFVSCVKRLKITRADGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62100	AUX_IAA	IAA30	indole-3-acetic acid inducible...		Lus10007193 [exp]	0	1
AT1G53708		RTFL9	ROTUNDIFOLIA like 9 (.1)		Lus10041259 [exp]	4.6	0.6884
					Lus10036759 [exp]	13.0	0.7075
AT2G32280			Protein of unknown function (D...		Lus10018495 [exp]	18.5	0.5778
AT3G22640		PAP85	cupin family protein (.1)		Lus10042617 [exp]	24.8	0.6241
AT1G20160		ATSBT5.2	Subtilisin-like serine endopep...		Lus10034544 [exp]	35.0	0.6394
AT2G34930			disease resistance family prot...		Lus10024737 [exp]	40.2	0.6206
AT5G13080	WRKY	ATWRKY75, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10012547 [exp]	42.8	0.6250
AT5G55090		MAPKKK15	mitogen-activated protein kina...		Lus10021551 [exp]	62.1	0.6154
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10024728 [exp]	154.4	0.5440

Compare expression of checked genes

Lus10007193 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.