Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015702 [exp] 201 / 2e-67 ND 38 / 0.004 Lus10032804 [exp] 189 / 3e-63 ND / Lus10010402 [exp] 188 / 8e-63 ND / Lus10017181 [exp] 183 / 4e-61 ND / Lus10012087 [exp] 177 / 1e-57 AT1G17930 57 / 4e-09 Aminotransferase-like, plant mobile domain family protein (.1) Lus10003272 [exp] 173 / 1e-56 ND 39 / 0.002 Lus10000686 [exp] 163 / 1e-52 AT1G17930 87 / 3e-20 Aminotransferase-like, plant mobile domain family protein (.1) Lus10008255 [exp] 156 / 7e-47 AT1G48120 49 / 1e-05 hydrolases;protein serine/threonine phosphatases (.1) Lus10008145 [exp] 131 / 2e-41 ND 34 / 0.006
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10536 [flax] [poplar] PMD Plant mobile domain
Representative CDS sequence Show only first row Show all	>Lus10007197 pacid=23167611 polypeptide=Lus10007197 locus=Lus10007197.g ID=Lus10007197.BGIv1.0 annot-version=v1.0 ATGGATTCCCGTGATGTTTGTTGGTTTCCTTTTGGGCCTCATCCCGACATTGAGGTCCCCGCCACGACTTACCGTGGTCTCCTACGTTGCGCCGATGTTG GGGAGTTCTACGATTCTTATCGTGTGCTCCGACAGTTTGGCTTCACACAGGTCGTCCCCCCCTCGATCCCTGTGCCGCTACGGGCCGTTAGGCCCAAATC TATCAGGACATATGCCGTCCAGTGGGCCCCGGCTGATGAGAGGATGTGGTTGGAGCAGGACTTCATCAGATTTCACCGGCTACACCTTATGTTCTAG
AA sequence Show only first row Show all	>Lus10007197 pacid=23167611 polypeptide=Lus10007197 locus=Lus10007197.g ID=Lus10007197.BGIv1.0 annot-version=v1.0 MDSRDVCWFPFGPHPDIEVPATTYRGLLRCADVGEFYDSYRVLRQFGFTQVVPPSIPVPLRAVRPKSIRTYAVQWAPADERMWLEQDFIRFHRLHLMF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10007197 [exp]	0	1
AT5G37810		NIP4;1, NLM4	NOD26-LIKE MIP 4, NOD26-like i...		Lus10016703 [exp]	2.4	0.8753
					Lus10006075 [exp]	13.3	0.8734
AT2G27410	B3		Domain of unknown function (DU...		Lus10027284 [exp]	19.4	0.8730
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Lus10028145 [exp]	21.9	0.8691
					Lus10013654 [exp]	25.7	0.8682
AT1G11340			S-locus lectin protein kinase ...		Lus10036139 [exp]	25.7	0.8690
AT5G15430			Plant calmodulin-binding prote...		Lus10003472 [exp]	26.2	0.8682
					Lus10000028 [exp]	31.3	0.8656
AT5G15430			Plant calmodulin-binding prote...		Lus10000141 [exp]	33.8	0.8663
AT2G04865			Aminotransferase-like, plant m...		Lus10025434 [exp]	35.3	0.8539

Compare expression of checked genes

Lus10007197 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.