Lus10007199 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42905 46 / 8e-07 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G25270 40 / 0.0001 Ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042473 49 / 7e-08 ND /
Lus10007550 46 / 1e-07 AT5G42905 44 / 1e-06 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G152100 39 / 0.0002 AT1G69700 102 / 1e-25 HVA22 homologue C (.1)
PFAM info
Representative CDS sequence
>Lus10007199 pacid=23167584 polypeptide=Lus10007199 locus=Lus10007199.g ID=Lus10007199.BGIv1.0 annot-version=v1.0
ATGGATCTTGACTGGTTGAACTGGTACCTCTCCATGTTATGGTATGGTTGGAAACAACGGAATCGAATCACTCATGGATCAGATCCTTGGCCGGAAATAG
CGTTTTGGCAGATGGTCCGCACCTTTGCAGGGGAGCTTCAGGCCCTTCAGTCCTGTGATCCAAAGCCGGTGGTTGTTCCTCGCTGGTTTGGTTGGCAGAA
ACCTCAGTCTGGATGGATTAAGATTAACGTTGATGGTAGTTGTCAGGCTGAGCTGAATTCTGCAGCTTTTAGCAGCGTACTGCGTGATGAAGATGGAGGG
TGGATTGCCACAAAACAACAATGA
AA sequence
>Lus10007199 pacid=23167584 polypeptide=Lus10007199 locus=Lus10007199.g ID=Lus10007199.BGIv1.0 annot-version=v1.0
MDLDWLNWYLSMLWYGWKQRNRITHGSDPWPEIAFWQMVRTFAGELQALQSCDPKPVVVPRWFGWQKPQSGWIKINVDGSCQAELNSAAFSSVLRDEDGG
WIATKQQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42905 Polynucleotidyl transferase, r... Lus10007199 0 1
AT5G05170 IXR1, CEV1, ATH... ISOXABEN RESISTANT 1, CONSTIT... Lus10007538 9.1 0.7849
AT4G05020 NDB2 NAD(P)H dehydrogenase B2 (.1),... Lus10011259 15.6 0.7252
AT3G03305 Calcineurin-like metallo-phosp... Lus10026788 16.3 0.7470
AT5G09890 Protein kinase family protein ... Lus10042650 19.1 0.7289
AT1G31850 S-adenosyl-L-methionine-depend... Lus10033277 19.6 0.7230
AT5G64740 PRC1, IXR2, E11... PROCUSTE 1, ISOXABEN RESISTANT... Lus10003526 19.8 0.7586
AT3G47570 Leucine-rich repeat protein ki... Lus10030638 20.3 0.7032
AT4G32410 AtCESA1, RSW1, ... RADIALLY SWOLLEN 1, cellulose ... Lus10028597 20.5 0.7603
AT1G03905 ABCI19 ATP-binding cassette I19, P-lo... Lus10024914 24.7 0.7079
AT5G64740 PRC1, IXR2, E11... PROCUSTE 1, ISOXABEN RESISTANT... Lus10002940 25.5 0.7577

Lus10007199 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.