Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01660 61 / 1e-12 ATABC1, ATATH10, ABC1At ABC transporter 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007201 [exp] 108 / 2e-29 AT4G01660 778 / 0.0 ABC transporter 1 (.1) Lus10010085 [exp] 107 / 6e-29 AT4G01660 780 / 0.0 ABC transporter 1 (.1) Lus10009257 [exp] 72 / 2e-18 AT4G01660 78 / 2e-18 ABC transporter 1 (.1) Lus10038017 [exp] 72 / 2e-16 AT4G01660 772 / 0.0 ABC transporter 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G185400 [exp] 67 / 4e-15 AT4G01660 691 / 0.0 ABC transporter 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10007202 pacid=23167590 polypeptide=Lus10007202 locus=Lus10007202.g ID=Lus10007202.BGIv1.0 annot-version=v1.0 ATGACTTCGTTTAAGAACCTAAGCAGACTCCTCGATGGCGTCTCCCTAGTCGCCAAGGAGATCGCGCTGCGCTCCCCTGCTCTTGAAGCTGCCTCTAAGG GAGACGTCCAAACCCTAATCTCATCCACCACCAGAAAGGCATTGCTCGCCGCCACCGACTTGTCTGGTGTTAAAATATGGATCTTTCACTCATAG
AA sequence Show only first row Show all	>Lus10007202 pacid=23167590 polypeptide=Lus10007202 locus=Lus10007202.g ID=Lus10007202.BGIv1.0 annot-version=v1.0 MTSFKNLSRLLDGVSLVAKEIALRSPALEAASKGDVQTLISSTTRKALLAATDLSGVKIWIFHS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G01660		ATABC1, ATATH10...	ABC transporter 1 (.1)		Lus10007202 [exp]	0	1
AT3G51620			PAP/OAS1 substrate-binding dom...		Lus10042221 [exp]	4.9	0.6792
AT5G26710			Glutamyl/glutaminyl-tRNA synth...		Lus10026044 [exp]	14.7	0.6940
AT5G26710			Glutamyl/glutaminyl-tRNA synth...		Lus10014335 [exp]	15.7	0.6831
AT3G50790			esterase/lipase/thioesterase f...		Lus10017327 [exp]	17.3	0.5925
AT1G09050			unknown protein		Lus10004495 [exp]	26.2	0.6754
AT3G22150			Tetratricopeptide repeat (TPR)...		Lus10003806 [exp]	30.9	0.6358
AT4G30950		FADC, SFD4, FAD...	STEAROYL DESATURASE DEFICIENCY...		Lus10035831 [exp]	34.4	0.6473
AT5G60760			P-loop containing nucleoside t...		Lus10016116 [exp]	37.8	0.6436
AT3G59710			NAD(P)-binding Rossmann-fold s...		Lus10037320 [exp]	40.3	0.5903
AT3G62830		ATUXS2, UXS2, A...	UDP-GLUCURONIC ACID DECARBOXYL...		Lus10030368 [exp]	42.1	0.6320

Compare expression of checked genes

Lus10007202 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.