Lus10007207 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10007207 pacid=23167589 polypeptide=Lus10007207 locus=Lus10007207.g ID=Lus10007207.BGIv1.0 annot-version=v1.0
ATGTTCATCCTGCTAGGAGCAGAGTGGACTGATATATTAGCATGGCCGGGGCGGAGGAGACCCATTGTTAGAGATCATGAAGAATGGTTTGAAGGAGCAA
CTTGGGGAGTTCTCATCATTGGTTGGGCAATGACCGTACGACCACCATCTGATTTGTTCATTTCGGCAAGAGACTGGATGTGCTCGATGATGTTTGACCG
AGCAAGGCAAATCTGCCCATGGAACAACATCCTCCTGAACTCGGAAAGTTCCGTCCGCACACATTTGAGACAGAATACTGAGGCATGTAATACCCTTGCC
ACAAAGGGAAAGCGGTCGATATGCATGAGAGAGATTCAAGAGCAGAGGGGGGACTAG
AA sequence
>Lus10007207 pacid=23167589 polypeptide=Lus10007207 locus=Lus10007207.g ID=Lus10007207.BGIv1.0 annot-version=v1.0
MFILLGAEWTDILAWPGRRRPIVRDHEEWFEGATWGVLIIGWAMTVRPPSDLFISARDWMCSMMFDRARQICPWNNILLNSESSVRTHLRQNTEACNTLA
TKGKRSICMREIQEQRGD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10007207 0 1
AT4G14385 unknown protein Lus10033887 6.3 0.7814
AT1G59077 unknown protein Lus10022089 13.5 0.8066
AT5G59140 BTB/POZ domain-containing prot... Lus10040746 13.6 0.8147
AT1G10890 unknown protein Lus10043141 26.3 0.7875
AT5G47890 NADH-ubiquinone oxidoreductase... Lus10030922 29.0 0.7930
AT5G52200 AtI-2 inhibitor-2, phosphoprotein ph... Lus10005751 33.4 0.7648
AT4G14965 ATMAPR4 membrane-associated progestero... Lus10018026 37.6 0.7691
AT2G40600 appr-1-p processing enzyme fam... Lus10034226 38.3 0.7795
AT5G06250 B3 AP2/B3-like transcriptional fa... Lus10004226 39.6 0.7530
AT1G01940 Cyclophilin-like peptidyl-prol... Lus10009237 41.4 0.7580

Lus10007207 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.