Lus10007208 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16260 77 / 1e-17 Glycosyl hydrolase superfamily protein (.1)
AT3G57270 69 / 2e-14 BG1 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
AT3G57240 66 / 2e-13 BG3 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1)
AT3G57260 65 / 5e-13 AtPR2, PR-2, PR2, BG2, BGL2 PATHOGENESIS-RELATED PROTEIN 2, "beta-1,3-glucanase 2", beta-1,3-glucanase 2 (.1)
AT3G07320 64 / 2e-12 O-Glycosyl hydrolases family 17 protein (.1)
AT5G56590 57 / 3e-10 O-Glycosyl hydrolases family 17 protein (.1)
AT2G05790 55 / 2e-09 O-Glycosyl hydrolases family 17 protein (.1)
AT4G26830 54 / 6e-09 O-Glycosyl hydrolases family 17 protein (.1)
AT4G18340 53 / 8e-09 Glycosyl hydrolase superfamily protein (.1)
AT2G16230 52 / 2e-08 O-Glycosyl hydrolases family 17 protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010091 172 / 4e-51 AT1G02305 520 / 0.0 Cysteine proteinases superfamily protein (.1)
Lus10014110 82 / 3e-19 AT3G57270 359 / 2e-124 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10027860 80 / 2e-18 AT3G57260 322 / 4e-109 PATHOGENESIS-RELATED PROTEIN 2, "beta-1,3-glucanase 2", beta-1,3-glucanase 2 (.1)
Lus10014108 79 / 6e-18 AT3G57270 366 / 3e-123 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10002807 75 / 1e-16 AT3G57240 339 / 7e-116 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1)
Lus10031037 75 / 2e-16 AT3G57240 312 / 3e-105 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1)
Lus10039233 71 / 4e-15 AT4G16260 258 / 5e-84 Glycosyl hydrolase superfamily protein (.1)
Lus10019801 70 / 1e-14 AT3G57270 367 / 6e-127 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Lus10027479 67 / 7e-14 AT4G16260 216 / 8e-69 Glycosyl hydrolase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G255100 98 / 5e-25 AT4G16260 369 / 9e-128 Glycosyl hydrolase superfamily protein (.1)
Potri.009G050300 84 / 4e-20 AT4G16260 285 / 5e-95 Glycosyl hydrolase superfamily protein (.1)
Potri.010G142800 81 / 8e-19 AT4G16260 433 / 2e-152 Glycosyl hydrolase superfamily protein (.1)
Potri.010G143166 78 / 7e-18 AT4G16260 432 / 5e-153 Glycosyl hydrolase superfamily protein (.1)
Potri.006G046100 74 / 3e-16 AT3G57270 370 / 4e-128 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.016G057600 66 / 3e-13 AT3G57270 414 / 2e-145 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.006G048100 62 / 4e-12 AT3G57270 382 / 6e-133 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.002G247900 59 / 1e-10 AT3G07320 653 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.016G057400 58 / 2e-10 AT3G57270 416 / 4e-146 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Potri.004G153800 53 / 9e-09 AT4G34480 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF00332 Glyco_hydro_17 Glycosyl hydrolases family 17
Representative CDS sequence
>Lus10007208 pacid=23167580 polypeptide=Lus10007208 locus=Lus10007208.g ID=Lus10007208.BGIv1.0 annot-version=v1.0
ATGGCCCTGCAAGCACTAAAGGGAAATAACATTCAACTCGTCCTAGACGTCCCCAACAGAGTCATCCCATCATTAATATCTGATGCCACTGTCGGGGTCC
ACACCAACATCTTGTCCTACTACCCTGCCGTCCAATTCCGCTACATTGTCGTGGGGAACGAGATCGGCCCCGACGACCCTATTGCTCCTAGCATCCTCCC
GGCTCTGACCAACATCAACAACATCCTTGCCGCCAACAATGCTGGCAGTGTGAAGGGGTCGACTACGATCAAATTGGTCTTGTTGGGAACATCATACCCA
CCCTCGGCTGGGGCATTAGCAGACAGTTCATCATCATTTATCATACCAATCGTGCAATACTTGGCAAACAACAACGCACCGTTACTTGCTAACGTGTATC
GGTTTTTCGCTTATATAGGAAATTCGGGACGTTGA
AA sequence
>Lus10007208 pacid=23167580 polypeptide=Lus10007208 locus=Lus10007208.g ID=Lus10007208.BGIv1.0 annot-version=v1.0
MALQALKGNNIQLVLDVPNRVIPSLISDATVGVHTNILSYYPAVQFRYIVVGNEIGPDDPIAPSILPALTNINNILAANNAGSVKGSTTIKLVLLGTSYP
PSAGALADSSSSFIIPIVQYLANNNAPLLANVYRFFAYIGNSGR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10007208 0 1
AT1G30670 bHLH bHLH052 basic helix-loop-helix (bHLH) ... Lus10005451 1.4 0.9735
AT1G02205 CER1 ECERIFERUM 1, Fatty acid hydro... Lus10011472 2.0 0.9559
AT2G43820 SGT1, ATSAGT1, ... UDP-glucose:salicylic acid glu... Lus10020559 4.0 0.8968
AT2G32350 Ubiquitin-like superfamily pro... Lus10039679 5.2 0.9093
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10041151 7.5 0.8515
AT3G18010 HD WOX1 WUSCHEL related homeobox 1 (.1... Lus10018011 9.5 0.8942
Lus10033149 10.7 0.8776
AT3G16180 Major facilitator superfamily ... Lus10009506 11.5 0.8776
AT1G58060 RNA helicase family protein (.... Lus10012695 11.7 0.7521
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10023215 12.3 0.8776

Lus10007208 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.